KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_51770Help
Entry
KPHS_51770        CDS       T01733                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kpm00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5195763..5197274
Genome map
AA seq 503 aa AA seqDB search
MTDKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPKPGWVEHDPMEIWASQSST
LVEALAKADINSDQIAAIGITNQRETVVVWERETGKPIYNAIVWQCRRTAEICEQLKRDG
MEEYIRKATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNIHDLDWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
AGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVTSTHGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAFQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NYRYSGWKKAVKRALAWEEHDEA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaaaaaatatatcgttgcgcttgaccagggcactaccagctcccgggccgtt
gtgatggatcatgatgccaatatcgtcagcgtctcccagcgagaatttgaacaaatttat
cctaagccaggctgggtcgaacacgacccgatggaaatctgggcttcccaaagctcgacg
ctggtcgaagcgctggccaaagcggatatcaactccgatcagatcgcggccatcggcatc
accaatcagcgtgagaccgtggtggtgtgggagcgagagaccggtaaacccatctacaac
gctatcgtctggcagtgccgccgtaccgcggagatctgcgagcagctcaagcgtgacggg
atggaagagtatatccgcaaggccacaggcctggtggtggacccgtacttctccggcacc
aaggtgaaatggatcctcgaccatgtcgaaggttcccgtgagcgtgcgaagcgcggcgag
ctgctgttcggcaccgttgacacctggcttatctggaagatgacccagggccgcgtgcac
gtcaccgactacaccaacgcctcgcgtaccatgctgttcaacattcacgacctcgactgg
gacgacaagatgctcgacgcgctggacattccgcgcgccatgctgccggaagtgcgcaag
tcttccgaagtgtacggccagaccaacatcggtggtaaaggcgggacccgtattcctatc
gccgggatcgccggtgaccagcaggcggccctgttcggccagctgtgcgtcaaagaaggg
atggcgaaaaacacctacggcaccggctgctttatgctgatgaataccggcgaaaaagcg
gtcacctccacccacggtctgctgaccaccatcgcctgcggcccgcgcggcgaggtgaac
tacgctctggaaggggcggtgtttatggccggcgcgtctattcagtggctgcgcgacgag
atgaagctcatcagcgatgccttcgactccgagtacttcgccaccaaagtgaaggatacc
aacggcgtatacgtggtacccgcgttcaccggtcttggcgcaccgtactgggacccgtat
gcccgcggcgcgattttcggcctcacccgcggcgtgaactccaaccacattatccgtgcg
acgctggagtccatcgcctttcagacccgcgacgtgctggaagcgatgcaggctgactcc
ggcattcgtctgcacgccctgcgcgtagacggcggcgcggtggctaacaacttcctgatg
cagttccagtccgatatcctcggcacccgtgtcgagcgtccggaagtacgcgaagtgacg
gcgctgggcgcggcctatctggccggtctggcggtcggtttctggcagaatctggatgaa
ctgcaggagaaagcggtgattgagcgcgaattccgcccggggattgaaactactgagcgt
aactatcgttacagcggctggaagaaagcggtgaaacgcgcgttagcgtgggaagagcac
gacgaagcgtaa

DBGET integrated database retrieval system