KEGG   Klebsiella pneumoniae subsp. pneumoniae HS11286: KPHS_p300720Help
Entry
KPHS_p300720      CDS       T01733                                 

Definition
dihydrofolate reductase
Orthology
K18590  
dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
kpm  Klebsiella pneumoniae subsp. pneumoniae HS11286
Pathway
One carbon pool by folate
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:kpm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KPHS_p300720
   00670 One carbon pool by folate
    KPHS_p300720
Enzymes [BR:kpm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KPHS_p300720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pKPHS3:complement(41494..41949)
Genome map
AA seq 151 aa AA seqDB search
MNSESVRIYLVAAMGANRVIGNGPNIPWKIPGEQKIFRRLTEGKVVVMGRKTFESIGKPL
PNRHTLVISRQANYRATGCVVVSTLSHAIALASELGNELYVAGGAEIYTLALPHAHGVFL
SEVHQTFEGDAFFPMLNEQNSSLSQPKPFKL
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaactcggaatcagtacgcatttatctcgttgctgcgatgggagccaatcgggttatt
ggcaatggtcctaatatcccctggaaaattccgggtgagcagaagatttttcgcagactc
actgagggaaaagtcgttgtcatggggcgaaagacctttgagtctatcggcaagcctcta
ccgaaccgtcacacattggtaatctcacgccaagctaactaccgcgccactggctgcgta
gttgtttcaacgctgtcgcacgctatcgctttggcatccgaactcggcaatgaactctac
gtcgcgggcggagctgagatatacactctggcactacctcacgcccacggcgtgtttcta
tctgaggtacatcaaaccttcgagggtgacgccttcttcccaatgctcaacgaacagaat
tcgagcttgtctcaaccgaaaccattcaagctgtaa

DBGET integrated database retrieval system