KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00004Help
Entry
KPN_00004         CDS       T00566                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPN_00004 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN_00004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KPN_00004 (thrC)
Enzymes [BR:kpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KPN_00004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3737..5017
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDDMLAQDFVTRSAKILC
AFIGDEIPQDVLQQRVRAAFAFPAPVSKVQEDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQICYYFEAAAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRYLQGGEWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAMRELKAIGYISEPHAAIAWRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgagcaggtcagctttgcgcaggccgtcacc
cagggacttggcaagcatcagggcctgttctttccgcacgatctgccggaattcagcctg
actgaaatcgacgacatgctggcgcaggactttgtcacccgtagcgccaaaattttatgc
gcctttatcggcgatgagatcccgcaggatgtcctgcagcagcgggtgcgcgcggcgttt
gcgtttccggcgccggtaagtaaggttcaggaagatgtcggctgtctggagctgttccat
ggccctacgctggcgttcaaggatttcggcggccgctttatggcgcagatgctgacccac
atcgcaggcgataagccggtcaccatcctcaccgcgacctctggcgacaccggggcggcg
gtggcgcatgctttctacggcctgccgaacgtcaaggtagtgatcctctatccgcgcggc
aagatcagtccgctgcaggagaagctgttctgtaccctcggcggcaatattgaaaccgtg
gcgattgatggcgactttgatgcctgccaggcgctggtgaagcaggcgtttgacgatgaa
gagctgaaggcgacgctgggtctcaactcggctaactccatcaacatcagccgcctgctg
gcgcagatctgttactacttcgaagcggcggcgcagctgccgcaggaagcccgcaatcag
ctggtgatttccgtgccgagcggcaacttcggcgatctgaccgccggtctgctggccaag
tcgctggggctgccgatcaagcgctttatcgccgccaccaacgccaacgacaccgttccg
cgctatctgcagggcggcgagtgggcgccaaaagccacccaggcgacgctgtccaacgcc
atggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccgccgtaaaatc
tggcgtctcagcgagctgggctatgccgcggtcgatgatgagaccaccaaagcagcgatg
cgcgagctgaaggccatcggctacatctctgaaccgcatgcggcgattgcctggcgcgcg
ctgcgcgatcagctgcagccgggagagtacggcctgttcctcggcaccgcccatccggcg
aagttcaaagagagcgtggaggagatcctgcaggagactctgccgctgccgaaggagctg
gccgaccgcgccgacctgccgctgctgtctcacaacctgccggcggatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system