KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00045Help
Entry
KPN_00045         CDS       T00566                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KPN_00045 (folA)
   00670 One carbon pool by folate
    KPN_00045 (folA)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     KPN_00045 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
49985..50464
Genome map
AA seq 159 aa AA seqDB search
MISLIAALAVDRVIGMENAMPWNLPADLAWFKRNTLNKPVVMGRLTWESIGRPLPGRKNI
VISSKPGSDDRVQWVSSVEEAIAACGDVEEIMVIGGGRVYEQFLPKAQKLYLTHIDAEVE
GDTHFPDYDPDEWESVFSEFHDADAQNSHSYCFEILERR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatcagtctgattgcggcgttagcggtagatcgcgtcattggtatggaaaacgccatg
ccatggaacctgcctgccgatctcgcctggttcaaacgcaacacgttaaataagccggtg
gtgatggggcgtctgacctgggaatccattgggcgcccattgccggggcgtaaaaatatc
gtgatcagcagcaaacccggcagcgacgatcgcgtgcagtgggtctcctccgtagaagaa
gcaattgccgcctgcggcgatgtggaagagattatggtgatcggcggcggccgggtgtat
gagcagttcctgccgaaagcgcagaagctctacttgacccatattgatgcggaagtggaa
ggcgatacccatttcccggattacgatccggacgaatgggagtcggtgttcagcgagttt
catgacgccgacgcgcagaactcccatagctactgctttgagatcctcgaacgccgttaa

DBGET integrated database retrieval system