KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00186Help
Entry
KPN_00186         CDS       T00566                                 

Gene name
ispC
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPN_00186 (ispC)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     KPN_00186 (ispC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219232..220434
Genome map
AA seq 400 aa AA seqDB search
MKQLTVLGSTGSIGCSTLDVVRHNPGRFSVAALVAGKNVDRMVEQCLEFTPRYAVMDDAQ
SAERLRTRLHEHGSRTEVLSGQQAAAEVAALDEVDQVMAAIVGAAGLVPTLAAIRAGKTV
LLANKESLVTCGRLFMEAVQQSGARLLPVDSEHNAIFQSMPETIQQHLGYADLAQNGVSS
ILLTGSGGPFRETAVAELAAMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAQQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMGWPQRLNSGVKPLDFC
QLSNLSFSAPDYTRYPCLKLAMDAFDVGQAATTTLNAANEESVAAFLHGDIRFTDIAAVN
LAVLDKMDLQEPQSIDDVLVIDAEARAIAHQQLQRLVAQA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaattaaccgttctcggttcgaccggctccattggctgtagcacgctggacgtg
gtgcgccataaccctggtcgcttttccgtcgccgcgctggtcgcggggaaaaacgttgac
cgtatggttgaacaatgcctggaatttaccccccgttacgcggtgatggacgatgcgcaa
agcgctgagcggttgcgcacccgtctgcatgagcatggcagtcgcaccgaggtgctgagc
ggccagcaggcggcggcagaggtcgcggcgctggatgaggtcgatcaggtcatggcggca
atcgtcggcgcggcgggactggtgccgacgctggcggcgatccgcgccgggaaaacggta
ttgttagcgaataaagaatcgctggtgacctgcggtcgcttattcatggaggcggtgcaa
cagtcgggggcgcgattgctaccggtcgatagcgagcataacgctatttttcagagtatg
ccggagacaattcagcagcatctgggatacgctgatcttgcccagaacggcgtctcgtct
atcctgctgaccggctccggtgggcctttccgcgagacggccgtggctgaactggcggcg
atgaccccggatcaggcctgccgtcatcccaactggtcgatggggcgcaagatctccgtt
gattcggccacgatgatgaacaaaggcctggaatatattgaagcgcgctggctgtttaac
gcctcggcccagcagatggaagtgctgatccatccgcagtcggtgatccactcgatggtt
cgctatcaggatggcagcgtgctggcccagcttggggagccggatatgcgcacgccgatc
gcccataccatgggctggccgcagcgactgaattccggcgttaaaccgctggacttctgt
cagttgagcaatctgagcttctccgcgccggactatacgcgatatccgtgcctgaagctg
gcgatggacgcgtttgacgtcggccaggccgcgaccacgacgctgaatgcggctaatgaa
gagtcggttgccgcgtttctgcatggcgatatccgctttaccgatattgcggcggttaac
ctggcggtgctggataagatggacctgcaggagccgcaaagcattgatgatgttctggtt
atcgacgccgaggcgcgcgcaatcgctcaccagcagctgcagcggttggttgcgcaggcg
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system