KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00431Help
Entry
KPN_00431         CDS       T00566                                 

Definition
putative glycoside hydrolase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpn00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474401..476458
Genome map
AA seq 685 aa AA seqDB search
MNKFAPLHPKVSTLLHGADYNPEQWENDPDIIDKDIAMMQQAKCNVMSVGIFSWAKLEPR
EGVFNFAWLDIILDKLYAAGIHVFLATPSGARPAWMSQRYPQVLRVGRDRVPALHGGRHN
HCMSSPVYREKTLQINTLLAERYSSHPAVLGWHISNEYGGECHCDLCQNRFRDWLKARYQ
TLENLNQAWWSTFWSHTYTDWSQIESPAPQGEMSIHGLNLDWHRFNTAQVTDFCRHEIAP
LKAANASLPVTTNFMEYFYDYDYWRLAEALDFISWDSYPMWHRDKDETALACYTAMYHDM
MRSLKGGKPFVLMESTPGATNWQPTSKLKKPGMHILSSLQAVAHGADSVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRIGREVCQLGVILSKLPEVRGCRTEAKVAIIFDQQNRWALDDA
QGPRNLGMEYEKTVNEHYRPFWEQGIAVDVIDADVDLTPYQLVIAPMLYMVRDGFAGRAE
AFVANGGHLVTTYWTGIVNESDLCYLGGFPGPLRNLLGIWAEEIDCLNDGEFNLVQGLAG
NQCGLQGPYQVRHLCELIHIESAQALATYRDDFYAGRPAVTVNAFGKGKAWHVASRNDLA
FQRDFFTALSKELALPRAIATELPPGVVATARTDGDNAFIFLQNYSAQNHTLTLPQGYWD
CLTDAAVSAPLTLSAWDCRILRRHA
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaataaatttgcacctttacatccgaaggttagtacgctgctgcatggcgcggattat
aatccggagcaatgggagaatgaccccgatattattgataaagacattgccatgatgcag
caggcaaaatgcaatgtgatgtcggtgggaatatttagctgggcgaaactggagccacgc
gaaggggtatttaatttcgcctggctggatattatcctcgataaactgtatgccgccggc
attcatgtctttctggccacgccgagcggcgcgcgtccggcgtggatgtcgcagcgctat
ccgcaggttctgcgggtggggcgcgatcgggtgccggccctgcacggcggccgtcacaac
cactgtatgtcgtcaccggtctatcgcgagaaaaccctgcaaatcaataccctgctggca
gaacgttattcctcacacccggcggtgctgggctggcatatttccaacgaatatggcggt
gaatgccattgcgatctctgccagaaccgttttcgcgactggctgaaggcgcgttaccag
accctggagaacctcaaccaggcctggtggagcaccttctggagtcatacctataccgac
tggtcgcagattgaatcgcctgcgccgcagggcgagatgtcgatccacggtcttaatctt
gactggcatcgctttaacaccgctcaggtgactgatttctgccgccatgaaattgctccg
ctgaaggcggcgaatgcctccctgccggtgactaccaactttatggagtatttctacgat
tacgactactggcggctggcggaggcgctggatttcatctcctgggacagctatccgatg
tggcaccgcgataaagacgaaaccgcgctggcctgttacaccgcgatgtatcacgacatg
atgcgcagcctgaagggcggcaaaccgtttgtgctgatggagtccaccccgggcgccacc
aactggcagccgaccagcaaactgaagaagccgggaatgcatattctttcctcgctgcag
gcggtggcgcatggcgccgactcggtgcagtatttccagtggcggaaaagccgcggttcg
gttgagaaatttcacggcgcagtggtcgaccacgtcggacatattgatacccgcattggc
cgcgaagtctgccagctcggcgtgatcctcagcaagctgccggaagtgagaggctgtcgc
accgaggcgaaagtagcgattatcttcgaccagcagaaccgctgggcgctggatgacgcc
caggggccgcgtaatcttgggatggaatatgagaagacggtcaacgagcactaccgcccg
ttctgggagcagggcatcgccgtcgatgtgattgacgccgatgtcgatttaacgccgtat
cagttagtgattgccccgatgttatatatggtgcgcgacggctttgccggtcgggcggag
gcgtttgtcgccaacggcggccacctggtgaccacctactggaccggtatcgtcaatgag
tccgatctctgctatctcggcggcttcccgggcccgctgcgcaatctgctggggatctgg
gcggaagagatcgactgcctgaatgacggcgagtttaatctggtgcaggggcttgccggg
aatcagtgcggtctgcagggcccttatcaggtgcgccatctctgcgaactgatccatatc
gagagcgcccaggcgctggccacctaccgggatgatttttatgccggacggccggctgtg
acggtgaacgcgttcgggaaaggcaaagcctggcatgtggcctcccgcaacgatttagcc
ttccagcgcgatttctttaccgccctgagcaaggagctggccctgccgcgggcgatagcg
acggagttaccacccggcgtggtggcgactgcgcgcaccgacggtgacaacgcatttatc
ttcctgcagaactacagcgcgcaaaaccataccctgaccctgccgcaagggtattgggat
tgcctgaccgacgcggcggtatcggctccactgaccctgtcggcatgggattgccgtatt
ctccgtcgtcacgcgtaa

DBGET integrated database retrieval system