KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00454Help
Entry
KPN_00454         CDS       T00566                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:kpn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498659..499264
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtc
ggcccgaagtcagcgcagcgcatggcgtttaccctactgcagcgcgatcgcagcggcggg
atgcgcctggcgcaggcgctgacgcgtgcgatgtcggagatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatctgcagcaacccgcgtcgccaggaaaac
ggccagatctgcgtggtagagagtccggcggacatctatgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatggggcacctgtcgccgctcgacggcatcgggcct
gatgacatcgggctcgatcgcctggagcaacggctggaggcggagtcgatcaccgaggtg
atcctcgccaccaacccgaccgttgagggcgaggcgacggccaactacatcgcggagctg
tgcgcgcagtatggcgtcgacgccagccgaatcgcccacggcgtgccggtgggcggcgag
ctggagatggtcgacggcaccacgctgtcccactccctggccggtcgccacaagattact
ttctga

DBGET integrated database retrieval system