KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00454Help
Entry
KPN_00454         CDS       T00566                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    KPN_00454 (recR)
DNA repair and recombination proteins [BR:kpn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      KPN_00454 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498659..499264
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQYSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEAESITEVILATNPTVEGEATANYIAELCAQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaactagcccgctgttaactcagcttatggaagcgctgcgctgtctgccgggcgtc
ggcccgaagtcagcgcagcgcatggcgtttaccctactgcagcgcgatcgcagcggcggg
atgcgcctggcgcaggcgctgacgcgtgcgatgtcggagatcggccactgcgccgattgc
cgcaccttcaccgagcaggaggtgtgcaatatctgcagcaacccgcgtcgccaggaaaac
ggccagatctgcgtggtagagagtccggcggacatctatgccattgagcagaccgggcag
tattccggccgctacttcgtgctgatggggcacctgtcgccgctcgacggcatcgggcct
gatgacatcgggctcgatcgcctggagcaacggctggaggcggagtcgatcaccgaggtg
atcctcgccaccaacccgaccgttgagggcgaggcgacggccaactacatcgcggagctg
tgcgcgcagtatggcgtcgacgccagccgaatcgcccacggcgtgccggtgggcggcgag
ctggagatggtcgacggcaccacgctgtcccactccctggccggtcgccacaagattact
ttctga

DBGET integrated database retrieval system