KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00591Help
Entry
KPN_00591         CDS       T00566                                 

Definition
putative carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    KPN_00591
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     KPN_00591
Exosome [BR:kpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPN_00591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(667028..668527)
Genome map
AA seq 499 aa AA seqDB search
MSVNKDIIIALDEGTTNAKAVAFDSHGRVIAQFSRALEIATPQEGWVEQSAELLLAASLE
VISRAVAAVGAERVAALAISNQRETVVGWYRETGEAIAPALSWQCARTAAFCHMLREQGH
EPQIKAVTGLPVAPLFSASKMRWLLDHTPDGLNRAKNGEICLGTVDSWLLWHLTQGQHFC
CDYANASRTQLMNLHTADWDTDMLALFGIPRAALPVIKPSSGLFGYTAGLATLPDGIPVM
AMIGDSHAALFAHGLGAAGCVKATYGTGTSVMAPVDSVAFHVSNLATTVAWHDGEKLVYA
LEGNIPHTGDAVAWMADSTGLSERSPAELAQALNALPRSVDSTLGVFFVPALTGMGAPWW
DDKARGLIHGLSRGVKRAHLIRAALESITYQIADVITAMRAHHGFTLNTLLVDGGPTKND
WLMQYQADLLGCPVMRSDVAELSATGAALLARKALHKLTVAELQPFLPEHITYAPDLIRH
HRLVQRWQSWQHAVTLARR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaacaaggatattattattgccctcgatgagggcacaaccaatgccaaagcc
gttgccttcgacagccacgggcgggtaattgcgcaattttcccgcgcgcttgagatcgct
acgccgcaggaaggatgggtagaacagtcagcggagcttctgcttgccgcgtcgctggag
gtgatttctcgcgcagtggccgccgttggcgcggagcgtgtagccgccctggcgatcagc
aaccagcgcgaaaccgtcgtgggctggtatcgggaaacgggcgaggctatagcgcccgcc
ctgagctggcaatgtgcacgtactgccgcattttgccacatgctgcgtgaacaaggtcat
gagccgcagatcaaggcggtaaccggcctgccagtcgccccgctcttttccgcctcgaaa
atgcgctggctgctggaccacactccggatggtctgaaccgagcgaaaaatggcgagatt
tgcctcggtacggtggatagctggctgctctggcacctgacgcaaggccagcatttttgt
tgtgattatgccaacgcgtctcgtacgcagctcatgaatttgcacacagcggactgggat
accgatatgctcgccctgtttggcattccgcgtgcagcactcccggtaattaaaccttcg
agcggcctgtttggttacaccgcgggtttagccaccctccctgatggcattccggtaatg
gcgatgattggcgattcgcatgccgcccttttcgcccacggtctgggcgccgccggttgc
gttaaagccacttacggtacagggacctcggtgatggcgcccgtcgattcggtggcgttt
cacgtcagcaatctcgccaccacggtggcctggcacgacggagaaaagctggtctacgca
ctcgaggggaacattccccataccggcgatgcggtggcgtggatggccgacagtaccgga
ttgagcgaacgctctcccgccgaactggcccaggcgctgaatgctctgccccgttcggta
gattccaccttaggcgtcttttttgtgccggcgctcaccggcatgggcgccccctggtgg
gacgataaggcccgcggtttgatccatggattaagccggggcgtgaagcgggcccatctc
attcgtgccgcgctagaatcaattacctaccagattgccgatgtaatcactgcgatgcgt
gcccatcatggctttacgctcaacacgctgctggtggatgggggacccaccaaaaacgac
tggttaatgcagtaccaggccgacctgctaggttgtccggtgatgcgcagcgatgtggcc
gagctgtcggcgaccggcgcggcactgctggcgcgtaaagcgttgcacaagctgacggtg
gcagagcttcagccctttttaccagaacacatcacttatgcaccagacctgatccggcat
catcggcttgtgcaacgatggcagtcctggcaacacgcggtgacgctggcaagacgctga

DBGET integrated database retrieval system