KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00643Help
Entry
KPN_00643         CDS       T00566                                 

Definition
(GenBank) putative acireductone dioxygenase, ARD
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00270  Cysteine and methionine metabolism
kpn01100  Metabolic pathways
Module
kpn_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KPN_00643
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     KPN_00643
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     KPN_00643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 Cupin_1 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABR76093
UniProt: A6T672
Position
complement(731863..732405)
Genome map
AA seq 180 aa AA seqDB search
MSALTLFSVTDPQTPVWHSTDAKAIQAQLNAKGVRFERWQADRDLGANPSPETVIAAYQH
AIDKLVAEKGYQSWDVISLRADNPQKEALREKFLNEHTHGEDEVRFFVEGAGLFCLHIGD
EVFQVLCEKNDLISVPAHTPHWFDMGSEPNFTAIRIFDNPEGWIAQFTGDDIASAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcattaactcttttttccgtgaccgatccgcaaacgccggtctggcacagcacc
gacgccaaagcgattcaggcgcagcttaacgccaaaggcgtccgcttcgagcgctggcag
gccgaccgcgacctcggcgcaaatcccagcccggaaacggtgattgccgcctatcagcat
gcgattgataaactggtcgccgaaaagggctaccagagctgggacgtcatcagcctgcgc
gccgataacccgcaaaaagaggcgctgcgggaaaagttcctgaacgagcacacccatggc
gaagacgaggtgcggttttttgtcgagggcgctggcctgttttgcctgcacattggcgac
gaggtgttccaggtgctgtgcgaaaagaacgatctgatttcggttcccgcccacactccg
cactggtttgatatgggatcagaaccgaacttcaccgccattcgcatttttgataacccg
gaaggctggatcgcccagtttaccggcgacgatatcgccagcgcctacccgcggctggcg
taa

DBGET integrated database retrieval system