KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00768Help
Entry
KPN_00768         CDS       T00566                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN_00768 (gpmA)
   01230 Biosynthesis of amino acids
    KPN_00768 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_00768 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    KPN_00768 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN_00768 (gpmA)
Enzymes [BR:kpn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     KPN_00768 (gpmA)
Exosome [BR:kpn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   KPN_00768 (gpmA)
  Exosomal proteins of melanoma cells
   KPN_00768 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(854248..855000)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKAEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNAEEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactggttcgtcatggcgaaagccagtggaacaacgaaaac
cgcttcaccggttggtacgacgtggatctgtccgagaaaggcgttagcgaagcaaaagca
gcgggtaaactgctgaaggctgaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaagctgaacgagcgtcattacggcgcgctgcagggcctgaacaaa
gcggaaaccgctgagaaatatggtgacgagcaggttaaacagtggcgtcgcggcttcgct
gtcactccgccggagctgaccaaagacgacgagcgctacccgggccacgatccgcgctat
gcaaaactgaccgacgccgaactgccgaccactgaaagcctggcgctgactatcgaccgc
gtcgtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtgatc
atcgccgctcacggtaactccctgcgcgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatcctcgaactgaacatcccgaccggcgtaccgctggtatatgagttcgatgaa
aacttcaagccgatcaaacattactatctgggcaacgcggaagagatcgcggcgaaagct
gctgccgtcgccaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system