KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00847Help
Entry
KPN_00847         CDS       T00566                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_00847
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     KPN_00847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943788..945113
Genome map
AA seq 441 aa AA seqDB search
MQTEGAWNEGGKGMSVYDIRQPAEFASDWKVATDSYHRYREDFDLMQDLGMNCYRFQIAW
SRVCPDGDGEFNEQGIAFYHQFIDELIARGIEPMICLYHFDMPLSLAERYNGFTDRRVMD
AFIRYGQKMIACYGDKVKYWLTFNEQNLYHSPEAFLISGYLQGEKTLRELYLIQHHVMMA
HVHLTHYLHQTKPQCLMGGMLAHALVYPATCKPRDILCAQQLDEFLNQNLLRAYAGEGYS
PEVMHFVAAEGFDDIYRREDLALMATVKVDYLAFSYYASRTLNSDAIPPGTAVNNYMLFG
NQDNPFLKATEWNWQIDPLGFRTIITRYYNDWRLPVFPIENGIGVIESWDGEHPIADDYR
IAYHRDHINAMKAAIFEDGAQVIGYLGWGLIDILSSQGDMRKRYGVVYVNRENHDLKDLR
RVPKKSYAWLKQVFRSNGEAM
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggagggggcgtggaacgagggtggcaaggggatgtcggtgtatgatatccgt
caaccggcggagttcgcctccgactggaaggtggcgaccgactcttatcatcgttatcgg
gaagatttcgatttgatgcaggatctgggcatgaactgctaccgttttcagatcgcctgg
agccgggtgtgccctgacggagatggcgaattcaatgaacaggggattgccttctaccat
caatttatagatgaactgatcgcccgcggcattgagccgatgatctgcctgtaccacttc
gatatgccgctgtcgctggcggagcgctacaacggttttaccgaccgccgggtgatggac
gcttttatccgctacggccagaagatgatcgcctgctatggcgacaaggtgaaatattgg
ctcacctttaatgagcagaatctgtaccattcgccggaagcgtttctgatttccggctat
ctgcagggggagaagaccctgcgcgaactgtatctgatccagcatcatgtgatgatggcg
cacgtccatctgactcactatctgcaccagacgaagccgcagtgtctgatgggcggaatg
ctggctcacgctctggtctatccggctacctgcaaaccacgcgatatcctctgcgcccag
cagctggatgagttcttaaaccagaacctgctgcgcgcctacgcgggtgagggttatagc
ccggaggtgatgcattttgtcgccgcggaagggttcgatgatatctatcggcgggaggat
ctcgccctgatggcgacggtgaaggtcgattatctggcgttcagctattacgccagccgc
acattgaacagcgacgcgatcccgccgggaacggcggtcaacaactatatgctgtttggc
aaccaggataacccgttcctgaaagcgacggaatggaactggcagattgatccgctgggc
ttccggacgatcatcactcgttactataacgattggcgcctgccggtgttcccgattgaa
aacggcatcggggtgattgagtcctgggacggcgaacatcccattgccgatgattaccgc
atcgcttaccatcgcgaccatatcaacgccatgaaagcggccatctttgaggatggggcg
caggtgatcggctatctcggctggggattaatcgatatcctgagctcacagggcgatatg
cgtaagcgctacggcgtggtgtacgtcaatcgcgaaaaccatgacctcaaggacctgcgg
cgggtgccgaagaagagctatgcatggctgaagcaggtgttccgcagcaacggcgaagcg
atgtaa

DBGET integrated database retrieval system