KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00924Help
Entry
KPN_00924         CDS       T00566                                 

Gene name
ycaJ
Definition
recombination factor protein RarA
Orthology
K07478  
putative ATPase
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1037277..1038620
Genome map
AA seq 447 aa AA seqDB search
MSNLSLDFSDNAFQPLAARMRPENLAQYIGQQHLLAPGKPLPRAIEAGHLHSMILWGPPG
TGKTTLAEVIARYASADVERISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNK
SQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARVYLLKSLTTDDIERVLDQAMND
KTRGYGGQDIILPDETRRAIAELVNGDARRALNTLEMMADMAESDDSGKRVLKAELLTEI
AGERSARFDNKGDRFYDLISALHKSVRGSAPDAALYWYARIITAGGDPLYVARRCLAIAS
EDVGNADPRAMQVAISAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYTAFKAALADA
RDRPDYDVPVHLRNAPTKLMKEMGYGQEYRYAHDEPNAYAAGEQYFPQEMAQTRYYHPTN
RGLEGKIGEKLAWLAEQDQNSPIKRYR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatctgtcgctcgatttttccgacaacgcgtttcaacctctggccgctcgcatg
cggccagaaaatttagcgcagtatattggccagcagcacctgctggcgccgggtaaaccc
ctgccgcgggccattgaggccgggcacctgcattcgatgatcctctgggggccgccgggt
accggcaagaccactctggcggaagtgattgcccgctacgccagcgccgatgtcgaacgg
atctcagcggtaacctccggggtgaaagagattcgcgaggctattgagcgcgcgcggcag
aatcgcaacgccggccggcggaccatcctgtttgttgacgaagtgcatcgctttaataaa
agccagcaggatgcctttctgccgcatattgaagacggtaccattacttttattggcgcg
accaccgaaaacccctcctttgagcttaactcggcgctgctctcccgcgctcgcgtctac
ttactgaaatcgctcaccaccgacgatatcgagcgggtgcttgaccaggcgatgaacgat
aaaacccgcggctacggcggccaggatatcattttgccggatgagacccgcagggccatt
gccgagctagtgaacggcgacgcgcggcgagcgctgaataccctggaaatgatggccgat
atggccgaaagcgatgactcgggcaagcgggtgctgaaggcggaactgctgaccgagatc
gctggcgagcgcagcgcgcgctttgataataaaggcgaccggttctacgatttgatttcc
gccctgcataagtcggtgcgcggtagcgcgccggatgcggcactttactggtacgcgcgg
atcatcaccgccggcggcgatccgctgtacgttgcccgccgctgtctggcgattgcctcg
gaagatgtcggcaacgccgacccgcgggcgatgcaggtcgccatttcggcgtgggactgc
tttacccgcgtcgggccggcggaaggcgaacgggcgattgcccaggccattgtctatctg
gcctgcgcgccgaaaagcaacgcggtgtacaccgccttcaaagcggcgctggccgacgcg
cgggatcgtcctgactacgacgttccggtgcatctgcgcaatgcgccgacgaagctgatg
aaagagatgggctacggccaggagtatcgttacgctcatgacgaacccaacgcctacgcc
gccggcgagcagtacttcccgcaggaaatggcgcaaacgcgctattatcacccgacaaac
cgggggcttgagggcaaaattggcgaaaagctcgcctggctcgctgaacaggatcaaaat
agcccgataaaacgctaccgctaa

DBGET integrated database retrieval system