KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_00924Help
Entry
KPN_00924         CDS       T00566                                 

Gene name
ycaJ
Definition
(GenBank) putative polynucleotide enzyme
  KO
K07478  putative ATPase
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgsA_C AAA_assoc_2 AAA RuvB_N AAA_16 AAA_5 Mg_chelatase Sigma54_activat AAA_22 AAA_30 AAA_3 AAA_19 IstB_IS21 AAA_2 AAA_14 ResIII Sigma54_activ_2 DNA_pol3_delta2 RNA_helicase ABC_tran AAA_24 AAA_33 AAA_28 DUF815 ATP-synt_ab AAA_18 AAA_11 AAA_25 NACHT NTPase_1 Parvo_NS1
Motif
Other DBs
NCBI-ProteinID: ABR76360
UniProt: A6T6Y9
Position
1037277..1038620
Genome map
AA seq 447 aa AA seqDB search
MSNLSLDFSDNAFQPLAARMRPENLAQYIGQQHLLAPGKPLPRAIEAGHLHSMILWGPPG
TGKTTLAEVIARYASADVERISAVTSGVKEIREAIERARQNRNAGRRTILFVDEVHRFNK
SQQDAFLPHIEDGTITFIGATTENPSFELNSALLSRARVYLLKSLTTDDIERVLDQAMND
KTRGYGGQDIILPDETRRAIAELVNGDARRALNTLEMMADMAESDDSGKRVLKAELLTEI
AGERSARFDNKGDRFYDLISALHKSVRGSAPDAALYWYARIITAGGDPLYVARRCLAIAS
EDVGNADPRAMQVAISAWDCFTRVGPAEGERAIAQAIVYLACAPKSNAVYTAFKAALADA
RDRPDYDVPVHLRNAPTKLMKEMGYGQEYRYAHDEPNAYAAGEQYFPQEMAQTRYYHPTN
RGLEGKIGEKLAWLAEQDQNSPIKRYR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaatctgtcgctcgatttttccgacaacgcgtttcaacctctggccgctcgcatg
cggccagaaaatttagcgcagtatattggccagcagcacctgctggcgccgggtaaaccc
ctgccgcgggccattgaggccgggcacctgcattcgatgatcctctgggggccgccgggt
accggcaagaccactctggcggaagtgattgcccgctacgccagcgccgatgtcgaacgg
atctcagcggtaacctccggggtgaaagagattcgcgaggctattgagcgcgcgcggcag
aatcgcaacgccggccggcggaccatcctgtttgttgacgaagtgcatcgctttaataaa
agccagcaggatgcctttctgccgcatattgaagacggtaccattacttttattggcgcg
accaccgaaaacccctcctttgagcttaactcggcgctgctctcccgcgctcgcgtctac
ttactgaaatcgctcaccaccgacgatatcgagcgggtgcttgaccaggcgatgaacgat
aaaacccgcggctacggcggccaggatatcattttgccggatgagacccgcagggccatt
gccgagctagtgaacggcgacgcgcggcgagcgctgaataccctggaaatgatggccgat
atggccgaaagcgatgactcgggcaagcgggtgctgaaggcggaactgctgaccgagatc
gctggcgagcgcagcgcgcgctttgataataaaggcgaccggttctacgatttgatttcc
gccctgcataagtcggtgcgcggtagcgcgccggatgcggcactttactggtacgcgcgg
atcatcaccgccggcggcgatccgctgtacgttgcccgccgctgtctggcgattgcctcg
gaagatgtcggcaacgccgacccgcgggcgatgcaggtcgccatttcggcgtgggactgc
tttacccgcgtcgggccggcggaaggcgaacgggcgattgcccaggccattgtctatctg
gcctgcgcgccgaaaagcaacgcggtgtacaccgccttcaaagcggcgctggccgacgcg
cgggatcgtcctgactacgacgttccggtgcatctgcgcaatgcgccgacgaagctgatg
aaagagatgggctacggccaggagtatcgttacgctcatgacgaacccaacgcctacgcc
gccggcgagcagtacttcccgcaggaaatggcgcaaacgcgctattatcacccgacaaac
cgggggcttgagggcaaaattggcgaaaagctcgcctggctcgctgaacaggatcaaaat
agcccgataaaacgctaccgctaa

DBGET integrated database retrieval system