KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01054Help
Entry
KPN_01054         CDS       T00566                                 

Definition
(RefSeq) putative arginase/agmatinase/formimionoglutamate hydrolase
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPN_01054
  Amino acid metabolism
   00220 Arginine biosynthesis
    KPN_01054
   00330 Arginine and proline metabolism
    KPN_01054
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     KPN_01054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204306..1205190)
Genome map
AA seq 294 aa AA seqDB search
MTTQKVPMTSKTLRLIFPQWQGGNNPPYYLGSQLLSFLSPEAKGPVEIVPVELPTTEPLP
RINDITAKPSLIRQLNNAAALIEKHDPNSIVILGGDCLVSLAPFAHLLDKFGDKLGVLWI
DSHPDVQTAEQYPNAHAHVLGALMGTGDNDLVAHVKTKLNPSKIMIAGIHAPLPYEAEYL
TRHNITTLAPEQVKSGADEVLEWIAKEKIAYLAIHIDLDVLDPSLFRSILFAKPGRGKHD
FGDVAEGKLTIEDVLNLIAAATTKAVPVGLTIAEHLPWDMLNLKNMLSELPLLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacagaaggtaccaatgactagcaaaacactgcgacttatattccctcaatgg
caaggcggtaacaatcctccctactatcttggctcgcagctcctctcgtttctctctcct
gaagcaaaagggcccgttgagatcgttcctgttgagttaccaacaacagagccattgcca
aggattaatgacatcacggctaagccatccctcatcaggcaactcaataatgctgccgca
ctgattgaaaaacatgatcccaatagcattgtcattttaggcggagactgcctggtttcg
ctggcgcctttcgcccacctgctcgataagttcggagacaaactcggtgtgctctggatt
gactcgcatcctgacgtgcagacggctgaacaatatccaaacgcgcatgcccatgtgctt
ggtgcgctaatgggtacgggtgataacgatttagttgcccatgtaaaaaccaaacttaat
ccgtcaaaaataatgattgccggtatccacgcgccacttccttatgaagctgaatacctc
actcgccataacattacgacgctagcacctgaacaggttaaaagcggtgcagatgaagtc
ctggagtggatagcgaaagaaaagattgcgtatctggcgatccatatcgatctggacgta
ctcgacccatctctgttccgctccattctttttgcaaaaccggggcgcggaaaacacgat
tttggcgacgttgctgaaggcaaactgacgattgaggatgtactcaatctgatagcggca
gcgacgacaaaagcagtccccgttggcctgacaatcgctgaacatttgccctgggacatg
ctgaatctcaagaacatgctcagtgaattaccccttctaaagtaa

DBGET integrated database retrieval system