KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01054Help
Entry
KPN_01054         CDS       T00566                                 

Definition
putative arginase/agmatinase/formimionoglutamate hydrolase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:kpn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1204306..1205190)
Genome map
AA seq 294 aa AA seqDB search
MTTQKVPMTSKTLRLIFPQWQGGNNPPYYLGSQLLSFLSPEAKGPVEIVPVELPTTEPLP
RINDITAKPSLIRQLNNAAALIEKHDPNSIVILGGDCLVSLAPFAHLLDKFGDKLGVLWI
DSHPDVQTAEQYPNAHAHVLGALMGTGDNDLVAHVKTKLNPSKIMIAGIHAPLPYEAEYL
TRHNITTLAPEQVKSGADEVLEWIAKEKIAYLAIHIDLDVLDPSLFRSILFAKPGRGKHD
FGDVAEGKLTIEDVLNLIAAATTKAVPVGLTIAEHLPWDMLNLKNMLSELPLLK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacagaaggtaccaatgactagcaaaacactgcgacttatattccctcaatgg
caaggcggtaacaatcctccctactatcttggctcgcagctcctctcgtttctctctcct
gaagcaaaagggcccgttgagatcgttcctgttgagttaccaacaacagagccattgcca
aggattaatgacatcacggctaagccatccctcatcaggcaactcaataatgctgccgca
ctgattgaaaaacatgatcccaatagcattgtcattttaggcggagactgcctggtttcg
ctggcgcctttcgcccacctgctcgataagttcggagacaaactcggtgtgctctggatt
gactcgcatcctgacgtgcagacggctgaacaatatccaaacgcgcatgcccatgtgctt
ggtgcgctaatgggtacgggtgataacgatttagttgcccatgtaaaaaccaaacttaat
ccgtcaaaaataatgattgccggtatccacgcgccacttccttatgaagctgaatacctc
actcgccataacattacgacgctagcacctgaacaggttaaaagcggtgcagatgaagtc
ctggagtggatagcgaaagaaaagattgcgtatctggcgatccatatcgatctggacgta
ctcgacccatctctgttccgctccattctttttgcaaaaccggggcgcggaaaacacgat
tttggcgacgttgctgaaggcaaactgacgattgaggatgtactcaatctgatagcggca
gcgacgacaaaagcagtccccgttggcctgacaatcgctgaacatttgccctgggacatg
ctgaatctcaagaacatgctcagtgaattaccccttctaaagtaa

DBGET integrated database retrieval system