KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01104Help
Entry
KPN_01104         CDS       T00566                                 

Gene name
nagZ
Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kpn00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:kpn00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1252708..1253718
Genome map
AA seq 336 aa AA seqDB search
MLDVEGYELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIRDASRNHLVVAVDQE
GGRVQRFREGFTRLPAAQSFAALLGMEEGGKLAAEAGWLMASEMIAMDIDISFAPVLDVG
HISAAIGERSYHEDPQKALTMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETPFDPR
AASVIRDHDMAVFKSLIAEQRLDAIMPAHVIYPELDPRPASGSAYWLKTVLRGELGFDGV
IFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERVTKLY
HKGSFSRQELRDSARWKTVSAQLEQLHARWQEAKSA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgtcgaagggtatgagctggatgcggaagagcgagaaattctggcgcatccg
ctggtgggagggttgatcctctttacccgaaattatcacgatccggcgcagctgcgcgag
ctggtgcgccagatccgcgacgcctcccggaaccacctggtggtggcggtcgatcaggaa
ggggggcgggttcagcgtttccgcgaagggtttacccgtttaccggcggcccagtctttc
gccgcgctgctggggatggaagaggggggcaaactggccgccgaagccggctggctgatg
gccagcgaaatgatcgccatggatatcgatattagttttgcgccagtgctggacgtcggc
catatcagcgccgcaatcggcgaacgttcttatcatgaagatccgcagaaagcgctgacg
atggcgcgtcacttcattgacgggatgcacgccgcgggcatgaaaaccaccggcaaacac
ttcccgggacacggggcggtgactgccgattcgcacaaagagacgccgttcgatccgcgg
gcggcatcggttatccgcgaccatgatatggcggtgttcaaaagccttatcgccgagcag
cgtctggacgccattatgccggcgcatgtgatttacccggagctcgatccgcgtccggcc
agcggctcggcgtactggctgaaaacggtgctgcgcggcgaactgggctttgacggggtg
attttctccgacgatctgtcgatggaaggggcggcgatcatgggcagctatgccgaacgc
ggtcaggcatcgctcgacgccggttgcgatatgatcctcgtctgcaataatcgtaaaggc
gcggtcagtgtgctggataacctgtcgccgatcaaagcagagcgtgttacgaaattgtat
cataaaggttccttttcccgtcaggagttaagggattcagcccgttggaaaacggtgagt
gcccagctggagcagcttcatgcgcgctggcaagaggcgaagtccgcgtaa

DBGET integrated database retrieval system