KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01202Help
Entry
KPN_01202         CDS       T00566                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KPN_01202 (pncA)
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     KPN_01202 (pncA)
    3.5.1.-  
     KPN_01202 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1351109..1351750)
Genome map
AA seq 213 aa AA seqDB search
MAHRALLLVDLQNDFCAGGALAVPEGDSTVDVANALIDWSLARGEPIVASQDWHPADHGS
FASQHQVEPYTEGELDGLAQTFWPDHCVQHSEGAALHPLLKQQAIAAVFHKGQNRIIDSY
SAFFDNGHRQKTELDGWLRGQGIVELTVLGLATDYCVKFTVLDALALGYAVNVITDGCRG
VNLQPQDSSQAFMEMAAAGATLYTLDDWRETQA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcacatcgagcgctgttactggttgatttgcagaacgacttttgcgccggcggcgcg
ctggccgttcctgaaggcgacagtaccgtcgacgtagccaatgcgcttatcgactggagc
ctggcgcgcggcgagcccatcgtcgccagccaggactggcatccggcggatcacggcagt
ttcgccagccagcaccaggtggaaccctacaccgagggcgagctggacggcctggcgcaa
actttctggccggatcactgcgtgcagcacagcgaaggcgcggcgctgcatccgctgctc
aagcagcaggcgatcgccgctgtgttccacaaagggcaaaaccggatcatcgacagctat
agcgctttctttgacaacggtcaccggcagaaaaccgaactggacggctggctgcgtggt
caggggatcgtggagctgaccgttctcggcctcgccaccgattactgcgttaagttcacc
gtgctggatgccctggcgctgggctacgcggtcaacgtcatcaccgacggctgtcgcggc
gtaaatctgcagccacaggacagcagccaggcgtttatggagatggccgccgcgggcgcc
acgctctataccctcgacgactggcgggaaactcaggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system