KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01254Help
Entry
KPN_01254         CDS       T00566                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPN_01254 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPN_01254 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPN_01254 (trpB)
Enzymes [BR:kpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     KPN_01254 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1406976..1408169)
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPAFQAEFTDLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIEETNVGLIGVEPAGHGIESGEHGAPLKHGRVGIYFGMKSPMMQTADGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRADYVSITDDEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccctacttcggcgaattcggcggcatgtatgtgccgcagatc
ctgatgcccgccctgcgccagctggaagaagcctttgtcagcgcgcagaaggacccggcc
tttcaggcggaattcaccgacctgctgaaaaactacgccggtcgtccgacggccctgacc
aaatgccggaatctgaccgaaggcacccgcaccaccctgtatctgaaacgcgaagatctg
ctgcacggcggcgcgcacaaaaccaaccaggtgctgggccaggctctgctggccaaacgg
atgggcaaaactgaaattatcgccgagaccggcgccggtcagcacggcgtcgcctcagcg
ctggccagcgccctgctcggcctgaaatgccgtatctacatgggtgccaaggacgtcgag
cgccagtcgccgaacgtgttccgtatgcgcctgatgggcgccgaggtgatcccggtgcac
agcggctccgccacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagc
tacgaaaaggcgcactatatgctgggcaccgccgccggtccgcacccgttcccgacgatt
gtgcgtgaattccagcgcatgattggcgaagagaccaaagcgcagatccttgaaaaagag
ggccgcctaccggacgcggtgatcgcctgcgtcggcggcggatcaaacgccatcggcatg
ttcgctgattttatcgaggaaaccaacgtcggcctgatcggcgtggagcccgccggacac
ggtatcgagagcggcgagcacggcgcgccgctgaagcatggccgcgttgggatctacttc
ggtatgaagtcgccgatgatgcagaccgccgacggccagatcgaagagtcttactccatt
tccgccgggctggacttcccgtccgttgggccgcagcacgcgtttctgaacagcaccggt
cgcgctgactatgtgtcgatcaccgacgacgaagcgctggacgcgtttaaagcgctttcc
cgccacgaagggattatcccggcgctggagtcctctcacgctctggcccacgcgctgaag
atgatgcgcgagaacccggaaaaagagcagctgctggtggttaatctctccggccgcggc
gacaaagacattttcaccgtacatgacatcctgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system