KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01255Help
Entry
KPN_01255         CDS       T00566                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  
indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPN_01255 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    KPN_01255 (trpC)
Enzymes [BR:kpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     KPN_01255 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     KPN_01255 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1408179..1409537)
Genome map
AA seq 452 aa AA seqDB search
MQTVLAKIVADKAIWVEARKQQQPLASFQNEIVPTQRNFYDALAGTRTAFILECKKASPS
KGLIREDFDPAAIASIYKHYASAISVLCDEKYFQGSFDFLPIVSQVAPQPILCKDFTIDP
YQIYLARYYQADACLLMLSVLDDEQYRQLSAVAHSLNMGVLTEVSNEEELERAIVLKAKV
VGINNRDLRDMSIDLNRTRQLAARLGPDVTVISESGIHTYAEVRELSHFANGFLIGSALM
EQADLEAAVKRVLLGENKVCGLTRPQDAQVAWESGAIYGGLIFVPTSPRAVNDAQAKAVI
AAAPLQYVGVFRNAPLEEVVARAQALGLAAVQLHGDEDQAYIDALRDALADNVRIWKALS
VGETFPARTLHHVDKYLLDNGQGGSGQRFDWSLLQGQDLRNVMLAGGLGADNCVEAAKSG
CAGLDFNSGVESQPGIKDASKLASVFQTLRAY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccgttttagcaaaaatcgttgccgacaaagcgatttgggtggaagcccgcaaa
caacaacaaccgttagccagttttcagaatgagatcgtcccgacgcagcgcaatttctat
gacgcgctggccggcacccgcaccgcgtttattctcgagtgcaagaaggcctcgccgtcg
aaggggttgattcgcgaggatttcgatccggcagcgatcgccagcatctacaagcactac
gcctcggcgatctcggtgctgtgtgatgagaaatatttccagggcagcttcgatttcctg
ccgatcgtcagccaggtcgcgccgcagccgatcctgtgtaaggacttcaccatcgaccct
taccagatctacctggcgcgctactatcaggccgacgcctgtctgctgatgctctcggtg
ctcgacgatgaacagtatcgtcagctctcggcggtggctcacagcctgaatatgggcgtg
ctgaccgaagtcagcaatgaagaggaactggagcgcgccatcgtcctgaaggcgaaggtg
gtgggcattaacaaccgcgacctgcgcgatatgtcgattgaccttaaccgcacccgtcag
ctggcggcgcgtctcggcccggatgtcacggtgatcagcgaatccggcatccatacctat
gccgaagtgcgcgagctgagccacttcgccaacggcttcctgatcggctccgccctgatg
gagcaggcggatctggaagcggcggttaaacgcgtgctgctcggcgagaacaaagtgtgc
ggcctgacgcgcccgcaggatgcccaggtggcctgggagtccggcgccatttacggtggg
ctgatcttcgtcccgacctcgccgcgagcggtgaatgacgcccaggccaaagcggtgatc
gccgctgcgccgctgcagtacgtcggcgtcttccgcaatgcgccgctggaggaggtggtc
gcccgcgcgcaggctctggggctggccgccgtgcagctgcacggtgatgaagaccaggcc
tatatcgacgcgctgcgcgacgccctcgcggacaacgtccgcatctggaaagcgctgagc
gtcggcgaaaccttcccggcccgtacgctccaccatgtcgacaagtacctgctcgacaac
ggccagggcggcagcggccagcgctttgactggagcctgctgcagggccaggatctgcgc
aacgtcatgctggcgggcggcctcggcgccgataactgtgtggaagcggccaaaagcggc
tgtgccggactcgatttcaattcaggcgtagagtcgcaacccgggattaaagacgccagc
aagctggcctccgtattccagacgctgcgcgcatattaa

DBGET integrated database retrieval system