KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01474Help
Entry
KPN_01474         CDS       T00566                                 

Gene name
paaF
Definition
(GenBank) probable enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00071  Fatty acid degradation
kpn00280  Valine, leucine and isoleucine degradation
kpn00281  Geraniol degradation
kpn00310  Lysine degradation
kpn00360  Phenylalanine metabolism
kpn00362  Benzoate degradation
kpn00380  Tryptophan metabolism
kpn00410  beta-Alanine metabolism
kpn00627  Aminobenzoate degradation
kpn00640  Propanoate metabolism
kpn00650  Butanoate metabolism
kpn00903  Limonene and pinene degradation
kpn00930  Caprolactam degradation
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01212  Fatty acid metabolism
Module
kpn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPN_01474 (paaF)
   00650 Butanoate metabolism
    KPN_01474 (paaF)
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_01474 (paaF)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPN_01474 (paaF)
   00310 Lysine degradation
    KPN_01474 (paaF)
   00360 Phenylalanine metabolism
    KPN_01474 (paaF)
   00380 Tryptophan metabolism
    KPN_01474 (paaF)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPN_01474 (paaF)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPN_01474 (paaF)
   00281 Geraniol degradation
    KPN_01474 (paaF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN_01474 (paaF)
   00627 Aminobenzoate degradation
    KPN_01474 (paaF)
   00930 Caprolactam degradation
    KPN_01474 (paaF)
Enzymes [BR:kpn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPN_01474 (paaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABR76906
UniProt: A6T8I5
Position
1637027..1637794
Genome map
AA seq 255 aa AA seqDB search
MSDLLIHRHGRVLQLTLNRPQARNALNNALLTQIAEALEAAAVDDSVGVCVIRGNARFFA
AGADLNEMAEKDLPATLDDIRPRLWGRIDAFTKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDARQAQQAGLVSDIHPA
ALTDEYALKLATTIARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFSLLSATEDRREG
IDAFLQKRTPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgctgatccaccgtcatggccgggtgcttcagttgacgctgaaccgcccg
caggcccgcaacgcgctgaacaatgccttattaacccagattgccgaggcgctggaggcc
gcggcagttgatgacagcgtcggcgtctgcgttattcgcggtaacgcgcgttttttcgcc
gccggggctgaccttaatgaaatggcggaaaaagatctgcctgccaccctggatgatatt
cgcccacggttatgggggcgaattgatgcctttactaaaccgctcatcgcctcggtcaac
ggctacgccctcggcgccggctgcgagctggccctgctgtgcgacctgattgtcgccggg
gacaacgcccgctttggcctgccggaaattaccctcggcataatgccgggcgcgggcggc
acccagcggctgatccgcagcgttggcaaggcgctggccagccggatggtgctgagcggc
gagagtattgacgcccgccaggcgcagcaggccgggctggtcagtgatatccatccggcg
gcgttaaccgatgagtatgccctgaaactggcaaccaccattgcccgccattcgccgctg
gcgctacgggcggcaaaacagtcgctgcgcctgtcgcaggaagtcagcctgcaggctggt
ctgcaacaggagcgccagctgtttagcctgctgagcgccaccgaggaccgccgcgaaggc
atcgacgccttcttacaaaaacgtaccccggaatttaaaggacgctaa

DBGET integrated database retrieval system