KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01729Help
Entry
KPN_01729         CDS       T00566                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    KPN_01729
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     KPN_01729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1910258..1911130
Genome map
AA seq 290 aa AA seqDB search
MRVYVTGNITVDETWSIPDIPKKGASIHGVKVSQDIGGKGANQAIILSRCGIETRLIAAT
GNDSNGAWIRQQIKNEPLMLLPDGHFNQHSDTSIILNSADGDNAIITTTAAADTFSLDEM
IPHMADAVAGDILLQQGNFSLDKTRALFQYARSRGMTTVFNPSPVNPDFCHLWPLIDIAV
VNESEAELLQPYGVKTLVITQGAAGAWLVQEGQRQFCPAVPAEALDTTGAGDTFLAVMLA
SALLRGVAPDALALAHASRAAAITVSRRGTLSAFPGSRELAALLTTDGAR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtttacgttactggtaatattaccgtagatgaaacctggtccattccggatata
ccgaaaaaaggagcctccattcacggcgttaaagtgtcgcaggatatcggcggtaaaggc
gcgaaccaggcgattatattatcccgctgcggaatagagacgcgtttaattgccgccacg
ggtaatgacagcaacggcgcgtggatccgccagcagataaaaaatgaaccactgatgcta
ctacccgacggccatttcaatcaacatagcgatacctcgattattttaaatagcgctgat
ggcgacaacgccatcattaccactacggcggcggccgatacattcagcctggatgaaatg
attccgcatatggcggatgccgtcgctggcgatattctgctacagcagggcaatttctcc
ctcgataaaacgcgggcgctgttccagtacgccagaagccgcggcatgacgacggtattc
aacccctcacctgtcaatcctgacttttgccatctgtggcccctcatcgacatcgcggtg
gtcaatgaatccgaggccgagctgctccagccatacggggtgaaaaccttagtgattacc
cagggcgccgcaggcgcctggctggtccaggagggccagcgtcagttttgtcccgccgtg
cccgccgaggcgcttgatactaccggcgcgggcgacacgttcctcgccgtcatgttggcc
tccgccctgctgcgcggcgtcgcgccggatgcgctggcgctggcgcacgccagtcgcgct
gccgccattacggttagccgccgggggacgctcagcgcgtttcccggcagccgtgagctc
gccgccctgttaaccacggacggggcgcgctga

DBGET integrated database retrieval system