KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01735Help
Entry
KPN_01735         CDS       T00566                                 

Definition
putative acetylornithine deacetylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    KPN_01735
  Amino acid metabolism
   00300 Lysine biosynthesis
    KPN_01735
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     KPN_01735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1917454..1918596
Genome map
AA seq 380 aa AA seqDB search
MTATLELARQLLGFNTINPPGSEADCMRFFADWLDDSGFEVSLSSFGEGRCNLIASLPGA
KSGKPLAFTGHLDTVPLGNARWQYDPFGSQMEDGRLYGRGSSDMKAAIAAFAVACVHQRE
AILAGRGAVLLITGGEETGCDGARALIASATLPEVGALIVGEPTANYPVIGHKGALWLRC
ETRGKTAHGAMPELGINAIYLAADALGKIQHFSPGAPHPLMKQPTLNVGRIEGGLNINSV
PDRTRFDVDIRSAPNLQHATIRERLTTLLGESVTVSTLVDLPAVLSREDHAWIKQVYQRC
QPLHAEPIAPRVVPYFTDASLLLPALGDPPCIILGPGEPSMAHQTDEYCLLSRLAEAEQL
YGDIIRDWMASPPATKVKNE
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgacccttgagctcgcccggcagctgctgggctttaacaccatcaacccgccg
ggcagcgaagccgactgcatgcggttcttcgccgactggcttgacgatagcggttttgag
gtttcgctgtcgtcgttcggcgaaggacgctgcaatcttatcgccagcctgcccggggcg
aagagcggtaaaccgctggcctttaccggacatctggataccgtcccgctgggaaatgcc
cgctggcagtacgatcctttcggctcgcagatggaagacgggcgtctttatggccgcgga
tccagcgatatgaaagcggcgatagcggcgtttgccgtcgcctgcgttcatcagcgggaa
gcgatcctcgccggacgcggcgcggtattgctgataaccggcggagaagagaccggctgc
gacggcgcgcgggcgctgatcgcctccgcaacgttgccggaggtgggcgcgctgatcgtc
ggtgaacccaccgccaactatccggttatcggccataaaggcgcgctctggctacgctgc
gaaacgcgggggaaaaccgcccacggcgcgatgccggagctggggatcaatgctatctat
cttgcggcggatgcgttgggtaagattcagcatttttcgccaggcgcgccgcatccgcta
atgaagcaacccaccctcaacgtcggacgcatagaaggcggactcaatattaattccgta
ccggaccgcacgcgttttgatgtcgatatccgcagcgcgcccaatttacagcacgccact
atccgggagcgcttgacgacgctgcttggcgaaagcgtcaccgtctccacgctggtcgac
ctgcccgccgtcctcagccgggaggatcatgcgtggattaagcaggtttatcaacgctgt
cagccgctgcacgctgagccgattgcgccgcgcgtggtgccctactttaccgacgcctcg
ctgctgctgcctgcattgggcgatccgccctgtattattctcggccccggcgagccgtcg
atggcgcatcaaaccgacgaatactgcctgctcagccgactggcggaggccgaacagcta
tacggtgacatcattcgcgactggatggcatcaccgcccgcgacgaaagtaaaaaatgag
tga

DBGET integrated database retrieval system