KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_01853Help
Entry
KPN_01853         CDS       T00566                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00010  Glycolysis / Gluconeogenesis
kpn00071  Fatty acid degradation
kpn00350  Tyrosine metabolism
kpn00625  Chloroalkane and chloroalkene degradation
kpn00626  Naphthalene degradation
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_01853 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_01853 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPN_01853 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPN_01853 (adhP)
   00626 Naphthalene degradation
    KPN_01853 (adhP)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPN_01853 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABR77284
UniProt: A6T9L3
Position
2042310..2043320
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgttgttacccacgaccatcaggttaacgtcacggaaaaaacgctgcgc
ccgctggaatacggcgaagcgctgttgaaaatggaatgctgcggcgtgtgtcatactgac
ctgcacgtgaaaaacggcgattttggcgataaaaccggcgtcattctcggccatgaaggg
atcggggtggtacaaaaagtcggcccgggcgtcacctccctgaagccgggcgaccgcgcc
agcgtggcgtggttcttcgaaggctgcggccactgcgattactgtaacagcggcaacgag
acgctctgccgctcggtgaaaaacgccggctataccgtcgatggcggcatggcggaagag
tgcatcgtcaccgccaactacgcggtaaaagttccggacggcctcgactccgccgccgcc
agcagcatcacctgcgcgggcgtcaccacctacaaagcggtcaaggtctcccacatcaaa
ccgggccagtggatcgccatctacggcctcggcgggttgggtaacctcgcgctgcagtat
gcgaagaatgtctttaacgccaaagtgatcgctatcgacgtcaacgacggacagctggag
ctggcggcctcgatgggcgccgacctgaccatcaactcccgcaatgaagatgcggcgaaa
gtgattcaggaaaaaaccggcggcgcccacgctgcggtagtaaccgcggtggctaaagcg
gcctttaactcggcggtggatgccgttcgcgccggtggccgcgtggtcgcggtgggcctg
ccgccggaggcgatgagcctcgatattccgcgtctggtgctggacggcatcgaggtggtc
ggttcgctggtcggcacccgtcaggatctggtggaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcaccctgcgtccgctggaagatatcaacgctatcttcaaagag
atggagcaaggtcagatccgcggccgtatggttatcgatctgcgtagctaa

DBGET integrated database retrieval system