KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02118Help
Entry
KPN_02118         CDS       T00566                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPN_02118 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPN_02118 (mhpF)
   00650 Butanoate metabolism
    KPN_02118 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KPN_02118 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPN_02118 (mhpF)
   00622 Xylene degradation
    KPN_02118 (mhpF)
   00621 Dioxin degradation
    KPN_02118 (mhpF)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPN_02118 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2321339..2322289)
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRLGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLADN
LHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYILSELASQEAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDRPVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgcccggcgcctgggcgttgcgaccactcacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacatcgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgttatc
gacctgacgccggcggcgattggcccgtactgcgtaccggtggtcaacctcgcggacaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaggcgaccatcccgatggtc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagattgtggcctcgatcgccagc
caatccgccgggccgggcacgcgggccaatattgacgaattcaccgaaaccacctcgcag
gcgattgaaaaagtcggtggggcgggcaagggcaaagcgattattgtactgaaccctgcg
gagccgccgctgatgatgcgcgataccgtctacatcctgagcgagctggcgtcgcaggag
gcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggcttacgtcccgggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggacaggccggtcaacctgccc
ggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcgacg
gcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system