KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02199Help
Entry
KPN_02199         CDS       T00566                                 

Gene name
adhE
Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    KPN_02199 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_02199 (adhE)
   00620 Pyruvate metabolism
    KPN_02199 (adhE)
   00650 Butanoate metabolism
    KPN_02199 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_02199 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPN_02199 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPN_02199 (adhE)
   00626 Naphthalene degradation
    KPN_02199 (adhE)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPN_02199 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KPN_02199 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2407906..2410581
Genome map
AA seq 891 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKEATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AAKIAELAGFTVPATTKILIGEVTNVDESEPFAHEKLSPTLAMYRAKDFEDAVAKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFVEGEAGAKAEVAPVKAEKKAKKSA
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatatcgctgaactgaacgcgcttgttgagcgtgtcaagaaagcccag
cgtgaatatgccagtttcactcaagaacaagtcgacaaaatcttccgcgccgccgctctg
gccgctgcagatgctcgaatccctctcgccaaaatggccgtagccgaatccggcatgggc
atcgttgaagacaaagtgatcaaaaaccactttgcttccgaatacatttacaacgcttat
aaagacgaaaaaacctgtggcgttctgtcagaagacgacacctttggcaccatcactatt
gctgagcctatcggcatcatctgcggtatcgtaccgaccactaacccgacttcaacagcc
attttcaaatcgctcatcagtctgaaaacgcgtaacgccatcattttctctccgcacccg
cgtgcaaaagaagccaccaacaaagcggctgatatcgtgctgcaggctgccatcgcggcc
ggcgcgccgaaggacctgattggctggatcgatcagccgtctgtagaactgtctaacgcg
ctgatgcatcacccggacatcaacctgatcctggcgaccggtggtccaggcatggtgaaa
gcagcgtacagctccggtaaacctgctatcggcgtcggcgccggtaacaccccggtagtc
attgatgaaaccgccgacatcaaacgtgccgtagcgtccgtactgatgtctaaaaccttc
gataacggcgtgatctgtgcttctgagcagtccgttgtggtggttgattcagtctatgac
gcggttcgcgaacgtttcgccagccacggcggctatctgctgcagggtaaagagctgaaa
gccgttcaggacattatcctgaaaaatggcgcgctgaacgcggctatcgttggtcagcca
gcggccaaaatcgctgaactggcaggcttcaccgtgccggccaccaccaaaattctgatt
ggtgaagtgaccaacgttgacgagagcgagccgtttgctcacgaaaaactgtctccgacg
ctggctatgtaccgtgcaaaagatttcgaagacgcggtagccaaagcagaaaaactggtc
gccatgggcggtatcggccacacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgtggcttacttcggccaaatgatgaaaaccgcgcgtatcctgatcaacaccccggct
tctcagggtggtatcggtgacctgtacaacttcaaactcgcgccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgtcgtggctccctgccaatcgcactggatgaagtgattaccgatggtcacaaa
cgcgcgctgatcgtgactgaccgcttcctgttcaacaacggctatgccgatcagatcact
tccgtactgaaagctgcgggtgttgagacggaagtcttcttcgaagttgaagctgacccg
acgctgaccatcgtacgtaaaggtgccgacctggcaaactcctttaaaccagacgtgatc
atcgccctgggcggcggttccccgatggatgcggcgaaaatcatgtgggttatgtacgaa
catccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tataagttcccgaaaatgggcgtcaaagccaagatggtggcgatcactaccacttccggt
accggttctgaagttacgccgttcgccgtggtgaccgatgacgcgaccggtcagaaatac
ccgctggcagactacgcgctgaccccggatatggccattgtcgatgccaacctggtgatg
gatatgccgaaatcgctgtgtgcgttcggtggtctggatgcggtgactcacgccctggaa
gcttacgtttccgtactggcttctgagttctctgacggccaggcgctgcaggcgctgaaa
ctgctgaaagagtatctgccggcttcctatcacgaaggttccaagaacccggttgcccgt
gagcgcgtacacagtgccgcgactatcgccggtatcgcgttcgctaacgccttcctcggc
gtgtgtcactcgatggcgcacaaactgggctcccagttccatattccgcacggtctggcc
aacgccctgctgatctgcaacgttatccgctataacgcgaatgacaacccgaccaagcag
accgcgttcagccagtacgaccgtccgcaggctcgtcgtcgttacgctgaaatcgccgat
cacctgggcctctccgcaccaggcgaccgcaccgcagcgaaaatcgagaaactgctggca
tggctggaaagcattaaagctgagctgggtattccgaaatctatccgcgaagctggcgtt
caggaagctgacttcctggcccacgttgataaattgtctgaagatgcattcgatgaccag
tgcaccggcgctaacccgcgctacccgctgatctccgaactgaaacagatcctgctggat
acctactacggccgcgaattcgtcgaaggcgaagccggtgcgaaagccgaagttgctccg
gtaaaggctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system