KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02202Help
Entry
KPN_02202         CDS       T00566                                 

Gene name
galU
Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPN_02202 (galU)
   00052 Galactose metabolism
    KPN_02202 (galU)
   00500 Starch and sucrose metabolism
    KPN_02202 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    KPN_02202 (galU)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     KPN_02202 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2412437..2413339)
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSRDNLAEMISRFDETGASQIMVEPVEDVTAYGV
VDCKGESLKPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHKTLGDDFKAWLETAVAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtcagaaaagcggttatcccggttgcgggattaggcacc
aggatgctgccggccaccaaagcgattccaaaagaaatgctgccgctggtagataagccg
ttaattcagtacgttgttaatgaatgtatcgctgcaggaattactgaaattgttctggta
acgcactcgtcgaaaaactctatcgaaaaccatttcgataccagttttgagctggaagcg
atgctggaaaaacgtgtaaaacgccagctgctggaagaagtgcagtctatttgcccgccg
cacgtgactattatgcaagttcgtcagggcctggcgaaaggtctgggtcacgcggtgctg
tgcgcccatccggtagtgggagatgagccggtcgcggttattctgccagacgttattctg
gatgaatatgaatccgatctgagccgcgataacctcgctgagatgatctctcgcttcgat
gagactggcgccagccagattatggttgaacctgtcgaagacgtaaccgcttatggcgtg
gttgactgcaaaggcgaatccctgaagccgggcgaaagcgtaccgatggtgggcgtggtt
gagaagccaaaagctgacgttgcgccgtccaacctggcggtggtggggcgttatgtcctc
agcgccgatatctggccgctgctggcgaaaacccctccgggcgctggtgatgaaattcag
ctgactgacgccattgatatgctgatcgagaaagaaacggttgaagcttatcatatgaaa
ggcaagagccatgactgcggtaataagcttggctacatgcaggcgtttgtcgaatatggt
attcgtcacaaaacgctgggcgacgattttaaagcctggctggaaacggcggtagcgaag
taa

DBGET integrated database retrieval system