KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02411Help
Entry
KPN_02411         CDS       T00566                                 

Gene name
uvrC
Definition
excinuclease ABC subunit C
Orthology
K03703  
excinuclease ABC subunit C
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Nucleotide excision repair
Class
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:kpn03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2634077..2635843)
Genome map
AA seq 588 aa AA seqDB search
MYDAGGTVIYVGKAKDLKKRLSSYFRSNLASRKTEALVALIAQIDVTVTHTETEALLLEH
NYIKLYQPRYNVLLRDDKSYPFIFLSGDTHPRLAMHRGAKHAKGEYFGPFPNGYAVRETL
ALLQKIFPIRQCENSVYRNRSRPCLQYQIGRCLGPCVAGLVSEEEYAQQVEYVRLFLAGK
DDQVLTQLIARMEKASQNLEFEEAARIRDQIQAVRRVTEKQFVSNTGDDLDVIGVAFDAG
MACVHVLFIRQGKVLGSRSYFPKVPGGTELGEVVETFVGQFYLQGSQMRTLPGEILLDFN
LGDKTLLADSLSELAGRRINVQTKPRGDRARYLKLARTNAATALTTKLSQQSTIHQRLQA
LASVLELPAVKRMECFDISHTMGEQTVASCVVFDSNGPLRAEYRRYNITGITPGDDYAAM
NQVLRRRYGKAIDDNKIPDVILIDGGKGQLAQAKAVFAELDVPWDKHHPLLLGVAKGSDR
KAGLETLFFEPEGEGFSLPPDSPALHVIQHIRDESHDHAISGHRKKRAKVKSTSSLETIE
GVGPKRRQMLLKYMGGLQGLQQASVEEIAKVPGISHALAEKIFYSLKH
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgctggcggaaccgtcatctatgttggcaaagccaaagatctgaaaaagcgg
ctcagtagctacttccgcagcaaccttgcgtcgcgtaaaacggaagcgctggtagcgctg
atcgcgcaaatcgacgtgaccgtcacccacaccgagacggaagcgctgctgcttgagcac
aactatattaagctgtaccagccacgttacaacgtgctgttacgcgacgataaatcgtat
ccttttatttttctcagcggcgatactcatccgcgtctggcgatgcatcgcggcgccaaa
catgcgaagggcgaatattttggtccttttcccaacggctatgccgtgcgcgagaccctg
gcgctgctgcagaaaatctttcccatccgtcagtgtgaaaacagcgtctaccgcaatcgc
tcccgcccctgtctgcagtatcagattggtcgctgcctggggccgtgcgtggccgggctg
gtcagcgaagaagagtatgctcagcaggtagagtatgtgcggctgtttctcgccggcaag
gatgaccaggtgctgacccagctcatcgcgcggatggagaaggcgagccagaacctggag
ttcgaagaggccgcgcgcatccgcgaccagattcaggccgtccgccgcgtgacggagaaa
cagtttgtctccaacaccggtgacgacctcgacgtgatcggcgtcgccttcgatgccggc
atggcctgcgtgcatgtgctgtttatccgtcagggcaaagtgctgggcagccgaagctac
ttcccgaaagtgccgggcggcaccgagctgggagaggtcgtggagacctttgtcggccag
ttctacctgcagggcagccaaatgcgcacgctgccgggggagattttgctcgactttaac
cttggggataagacgctgctggccgactcgctgtcggagctggcgggtcgtcgaatcaat
gtgcagactaagccgcgcggcgacagagcgcgttatcttaagctggcgcggaccaacgcc
gcgacagcgttaacgaccaaattgtctcagcaatcgaccattcatcagcgtttgcaggcg
ctggccagcgtactggagctgccggccgtcaagcgaatggagtgttttgacatcagccac
accatgggcgaacagaccgtagcatcctgtgtggtgtttgacagcaatggcccactgcgc
gcggagtatcggcgctacaacatcaccggcattacccctggcgatgactatgcggcgatg
aatcaggtcctgcgccgtcgctatggtaaagcgattgatgacaacaagatcccggatgtg
atcctgatagacggcggcaagggacagctggcccaggcgaaagccgtgtttgctgaactg
gacgtcccctgggataaacatcatccgctgctgctgggcgtggcgaaaggtagcgatcga
aaagcgggtctggaaacgttattctttgagccggaaggggaagggtttagcctgccgccg
gattcgccggccctgcatgtgatccagcatattcgcgatgaatcgcacgatcatgcgatc
tccgggcatcgcaaaaaacgggcgaaagtgaagagcaccagctcgcttgagactatcgag
ggggtggggccgaagcgtcgtcagatgctgctgaagtatatgggtgggctgcaggggcta
cagcaggccagcgtcgaagaaattgctaaagtgccgggcatctctcacgctctggcagaa
aagatcttctactcgttgaaacattag

DBGET integrated database retrieval system