KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02488Help
Entry
KPN_02488         CDS       T00566                                 

Gene name
rmlC
Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00521  Streptomycin biosynthesis
kpn00523  Polyketide sugar unit biosynthesis
kpn01130  Biosynthesis of antibiotics
Module
kpn_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    KPN_02488 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KPN_02488 (rmlC)
Enzymes [BR:kpn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     KPN_02488 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABR77906
UniProt: A6TBD5
Position
complement(2715683..2716237)
Genome map
AA seq 184 aa AA seqDB search
MNIIKTDIPEVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVEFVQDNHSQSQKGVLRG
LHYQLDPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHG
FMALSDTVQFVYKATNYYAPQSERSIIWNDPEIGIDWPALGDCALSLSEKDLQAHTLATA
EVYA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacattattaaaacagatattcctgaggtgctgatttttgaaccgcgcgtgtttggt
gatgcgcggggtttcttctttgagagcttcagcagcaaggtgtttaatgaggcggtgggc
cgccaggtggaattcgtccaggacaaccactcccagtcccagaaaggcgtattgcgcggg
ctgcactatcagctggatccgcacgctcagggcaaactggtccgctgcgtggaaggtgag
gtatttgacgtggcggtggatatccgtcgttcatcgccaacctttggcaaatgggtgggc
gcggtgctcagcgcagagaataaacgtcagctgtggatcccggaaggattcgcccacggg
tttatggcgctgagtgacacggtgcagtttgtctacaaggcgacgaactactacgcgcca
cagtcagagcggagcatcatctggaacgatccggagatagggattgactggccggcgctg
ggcgactgcgcgctgtcgctgtcggagaaagatctgcaggcacatactcttgccacagct
gaagtctacgcataa

DBGET integrated database retrieval system