KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02494Help
Entry
KPN_02494         CDS       T00566                                 

Gene name
rmlC
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:kpn00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:kpn00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2723257..2723811)
Genome map
AA seq 184 aa AA seqDB search
MNIIKTDIPEVLIFEPRVFGDARGFFFESFSSKVFNEAVGRQVEFVQDNHSQSQKGVLRG
LHYQLDPHAQGKLVRCVEGEVFDVAVDIRRSSPTFGKWVGAVLSAENKRQLWIPEGFAHG
FMALSDTVQFVYKATNYYAPQSEQSIIWNDPEIGIDWPALSDCALSLSEKDLQAHTLATA
EVYK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaacattattaaaacagatattcctgaggtgctgatttttgaaccgcgcgtgtttggt
gatgcgcggggtttcttctttgagagcttcagcagcaaggtgtttaatgaggcggtgggc
cgccaggtggaattcgtccaggacaaccactcccagtcccagaaaggcgtattgcgcggg
ctgcactatcagctggatccgcacgctcagggcaaactggtccgctgcgtggaaggtgag
gtatttgacgtggcggtggatatccgtcgttcatcgccaacctttggcaaatgggtgggc
gcggtgctcagcgcagagaataaacgtcagctgtggatcccggaagggttcgcccacggg
tttatggcgctgagcgacacggtgcagtttgtctacaaggcgacgaactactacgcgcca
cagtcagagcagagcatcatctggaacgatccggagatagggattgactggccggcgctg
agcgactgcgcgctgtcgctgtcggagaaagatctgcaggcacatactctggccactgca
gaagtttataaataa

DBGET integrated database retrieval system