KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02688Help
Entry
KPN_02688         CDS       T00566                                 

Gene name
pta
Definition
phosphate acetyltransferase
Orthology
K13788  
phosphate acetyltransferase [EC:2.3.1.8]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Taurine and hypotaurine metabolism
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Class
Metabolism; Overview; Carbon metabolism [PATH:kpn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:kpn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:kpn00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:kpn00680]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:kpn00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2959347..2961479
Genome map
AA seq 710 aa AA seqDB search
MLIPTGTSVGLTSVSLGVIRAMERKGVRLSVFKPIAQPRSGGDAPDQTTTIVRASSSTTT
AAEPLKMSHVESLLSSNQKDVLMEEIIANYHANTQDAEVVLVEGLVPTRKHQFAQALNFE
IAKTLNAEIVFVMSQGTDTPEQLNERIELTRNSFGGAKNTSITGVIVNKLNAPVDDQGRT
RPDLSEIFDDSSKAKIVKIDPAQLQKGSTLPVLGAVPWSFDLIATRAIDMAHHLNATIIN
EGDINTRRVKSVTFCARSIPHMLEHFRPGSLLVTSADRPDVLVAACLAAMNGVEIGAILL
TGGYEMDARISKLCERAFATGLPVFMVNTNTWQTSLSLQSFNLEVPVDDHERIEKVQEYV
ANYINADWIESLTATSERSRRLSPPAFRYQLTELARKAGKRVVLPEGDEPRTVKAAAICA
ERGIATCVLLGNPDEINRVAAAQGVELGAGIEIVDPEVVRESYVGRLVELRKNKGMTEAV
AREQLEDNVVLGTLMLEQDEVDGLVSGAVHTTANTIRPPLQLIKTAPGSSLVSSVFFMLL
PEQVYVYGDCAINPDPTADQLAEIAIQSAESAIAFGIEPRVAMLSYSTGTSGAGSDVEKV
REATRLAQEKRPDLMIDGPLQYDAAVMADVAKSKAPNSPVAGRATVFIFPDLNTGNTTYK
AVQRSADLISIGPMLQGMRKPVNDLSRGALVDDIVYTIALTAIQSAQQQK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgttaattcctaccggtaccagcgtaggtctgaccagcgtcagcctcggtgtgatccgc
gctatggaacgcaaaggcgttcgtctgagcgtctttaaacctatcgcccagccgcgttcc
ggtggcgatgccccagaccagaccaccaccatcgttcgcgccagctcctccaccaccacc
gccgctgaaccgctgaagatgagccatgttgagtctctgctctccagcaatcagaaagat
gtgctgatggaagagatcattgccaactaccacgcgaatactcaggacgcggaagtggtg
ctggtggaaggcctggtaccgacccgtaagcatcagttcgcccaggcgctgaactttgaa
atcgccaaaacgctgaacgctgaaatcgtcttcgtgatgtctcagggcaccgacacgcca
gaacagctgaacgagcgtatcgaactgacccgtaacagctttggcggcgccaaaaatacc
agcatcaccggcgttatcgtcaacaaactgaatgcccctgtcgacgatcagggccgtacc
cgtcctgacctgtcggaaattttcgacgactcgtcgaaagcaaaaatcgtgaagattgac
ccggctcagctgcagaaaggcagcacgctgccggtgctgggcgcagtgccatggagcttc
gatctgatcgcgacccgcgcgatcgacatggctcatcatctgaatgcgaccatcattaac
gaaggcgatatcaatacccgccgcgtgaaatccgtgactttctgcgcgcgcagcatcccg
cacatgctggaacacttccgccctggttctctgctggttacctccgcagaccgtcctgac
gtgctggttgcggcctgcctggcggcaatgaacggcgtggaaatcggtgccattctgctg
accggcggctatgaaatggacgcgcgcatcagcaagctgtgtgaacgcgctttcgcgacc
ggcctgccggtattcatggtcaacaccaacacctggcagacctccctgagcctgcagagc
tttaacctcgaagtaccggttgacgatcacgagcgtatcgagaaagttcaggaatacgtg
gccaactacatcaacgccgactggatcgaatcgctgaccgcgacctccgagcgcagccgc
cgtctctctccgccagccttccgctaccagctgaccgagctggcgcgcaaagccggcaaa
cgtgtcgttctgccggaaggcgacgaaccgcgtaccgtgaaagcggcggcgatttgcgcc
gaacgcgggatcgccacctgcgtcctgctgggtaacccggatgagatcaaccgcgtagcc
gcggcccagggcgtggagcttggcgccggcattgaaatcgtcgatccggaagtggttcgc
gaaagctatgtgggtcgcctggtcgaactgcgtaagaacaaaggcatgaccgaagcggtc
gcgcgtgagcagctggaagacaacgtggttctcggcaccctgatgctggaacaggacgaa
gtcgacggtctggtatccggcgcggttcacaccactgccaacaccattcgtccgccgctg
cagctgatcaaaaccgcgccgggcagctcgctggtctcctccgtgttcttcatgctgctg
ccggaacaggtttacgtttacggcgactgcgcgatcaacccggacccgaccgccgatcag
ctggcggaaatcgctattcagtccgctgaatccgcgattgccttcggcatcgaaccgcgc
gtggcgatgctctcctactccaccggtacctccggcgcgggtagcgatgtcgagaaagtc
cgcgaagcgacccgtctggcgcaggaaaaacgtcctgacctgatgatcgacggcccgctg
cagtatgacgccgcggtgatggctgacgtagcgaagtccaaagcgccgaactcaccggta
gctggccgcgcgaccgtgttcatcttcccggatctgaacaccggtaacaccacgtacaaa
gcggtacagcgctctgccgacctgatctccatcgggccgatgctgcagggtatgcgcaag
ccggtcaacgacctgtcccgtggcgcgctggtagacgatatcgtctataccatcgcactg
accgcgatccaatcggctcagcagcagaagtaa

DBGET integrated database retrieval system