KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02738Help
Entry
KPN_02738         CDS       T00566                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN_02738 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_02738 (glk)
   00052 Galactose metabolism
    KPN_02738 (glk)
   00500 Starch and sucrose metabolism
    KPN_02738 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    KPN_02738 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    KPN_02738 (glk)
   00524 Butirosin and neomycin biosynthesis
    KPN_02738 (glk)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     KPN_02738 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3009534..3010499)
Genome map
AA seq 321 aa AA seqDB search
MTKFALVGDVGGTNARLALCDLASGEISRAKTYSGLDYPSLEAVVRVYLEEHQVTVNEGC
IAIACPITGDWVAMTNHTWAFSIAEMKRNLGFAHLEIINDFTAVSMAIPMLKAEHLIQFG
GSAPVAGKPIAVYGAGTGLGVAHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
LGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPREVTERALADSCTDCRRALSLFCVI
MGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKAYVQDIPVYLIV
HDNPGLLGSGAHLRQTLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgctttagtaggagatgtcggggggaccaacgcccgcctggcgctatgt
gatctggcgagtggagagatctctcgcgcaaagacctattccgggctcgattaccccagt
ctggaggcagtggtgcgcgtctatctcgaggagcatcaggtaacggtcaacgaaggttgt
atcgccatcgcatgcccgattaccggcgactgggtggcgatgaccaaccatacctgggct
ttctctatcgccgaaatgaagcgtaacctcggctttgcccatctggagataattaacgat
tttaccgctgtttcaatggccattccgatgctgaaagctgagcaccttattcagtttggc
ggcagtgcgccggtagcgggcaaaccgatcgccgtttatggcgccgggaccgggctcggc
gtggcgcatctggtccacgttgataagcgttgggtcagcctgccgggcgaaggcggtcat
gttgattttgccccgaacagcgaagaagaagggatcattctggaagagctacgcgccgag
ctggggcatgtttccgcagaacgcgtgctctcaggtcccgggctggtcaacctgtatcgc
gcgattgtcaaatcggacggccgactgccggagaacctgcagccgcgtgaggtgaccgag
cgagcgctggcggacagctgcaccgactgtcgtcgggcgctgtcgctgttctgcgtcatt
atgggacgcttcggcggtaacctggcgctgaccctcgggacgtttggcggggtgtatatc
gccggcggcatcgtgccgcgcttcctggagttctttaaagcctctggtttccgcggcggt
tttgaagacaaaggccgttttaaagcttatgttcaggatatcccggtttacctgatcgtg
catgataacccaggcctgctgggctccggcgcgcatctgcgtcagacgctgggccaggtg
ctttaa

DBGET integrated database retrieval system