KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02973Help
Entry
KPN_02973         CDS       T00566                                 

Definition
(GenBank) putative arginase/agmatinase/formiminoglutamase
  KO
K12255  guanidinobutyrase [EC:3.5.3.7]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00330  Arginine and proline metabolism
kpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KPN_02973
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     KPN_02973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase B12-binding_2 UPF0489
Motif
Other DBs
NCBI-ProteinID: ABR78379
UniProt: A6TCQ8
Position
3269233..3270183
Genome map
AA seq 316 aa AA seqDB search
MDNLFHQPQGGNEMPRFAGRATMMRLPFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQIIEDYYTGLNSYPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLMAEVRQQMGNGPVYLSFD
IDSLDPIWAPGTGTPEVGGLSSIQALEIVRGCRGLNLIGADLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggccgc
gccacaatgatgcgcctgccgtttattgaagatttacagggacttgacgcggcgtttgtc
ggcattccgctggatatcggcacctcgcagcgctcgggcacgcgctacggaccacgctat
attcgcgccgaatcggtgatgatccgtccgtacaatatggcgaccggcgccgcgccgttc
gactcgctgtcggtggctgatatcggcgatgtgccgatcaatacctacagcctgctcaaa
tcggtgcaaattatcgaagattactacactggtttgaatagttatccgctgatcccgctg
accctcggcggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacat
ggtccggtggggctcatccacgtcgacgcccataccgacaccaatgatgagatgttcgga
gagaaaatcgcccacggcaccaccttccgccgcgccgttgaggagggactgctcgacctc
aaacgggtggtgcagattggtcagcgcgcccagggctatgccgccggcgacttccagtgg
ggcgttgaccagggctttcgcctggtgcaggcggagcagtgctggcatacctcgctggcg
ccgctgatggccgaagtccgccagcagatgggcaacgggccggtgtatctcagctttgat
atcgacagcctcgatcccatctgggctccaggaaccgggacgccggaagttggcggtctg
agctccattcaggcgctggagatcgtccgcggctgccgcggcctgaacctgattggcgcc
gatctggtcgaggtctcgcccccctacgacgtgagcggtaatacctcccagctggcggcc
aacctgctgtacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system