KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_02973Help
Entry
KPN_02973         CDS       T00566                                 

Definition
putative arginase/agmatinase/formiminoglutamase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:kpn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3269233..3270183
Genome map
AA seq 316 aa AA seqDB search
MDNLFHQPQGGNEMPRFAGRATMMRLPFIEDLQGLDAAFVGIPLDIGTSQRSGTRYGPRY
IRAESVMIRPYNMATGAAPFDSLSVADIGDVPINTYSLLKSVQIIEDYYTGLNSYPLIPL
TLGGDHTITLPILRALTKKHGPVGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDL
KRVVQIGQRAQGYAAGDFQWGVDQGFRLVQAEQCWHTSLAPLMAEVRQQMGNGPVYLSFD
IDSLDPIWAPGTGTPEVGGLSSIQALEIVRGCRGLNLIGADLVEVSPPYDVSGNTSQLAA
NLLYEMLCVLPGVKYA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggataacctctttcaccaaccgcagggtggcaatgagatgccacgcttcgccggccgc
gccacaatgatgcgcctgccgtttattgaagatttacagggacttgacgcggcgtttgtc
ggcattccgctggatatcggcacctcgcagcgctcgggcacgcgctacggaccacgctat
attcgcgccgaatcggtgatgatccgtccgtacaatatggcgaccggcgccgcgccgttc
gactcgctgtcggtggctgatatcggcgatgtgccgatcaatacctacagcctgctcaaa
tcggtgcaaattatcgaagattactacactggtttgaatagttatccgctgatcccgctg
accctcggcggggaccacaccattaccctgccgatcctgcgggcgctgaccaaaaaacat
ggtccggtggggctcatccacgtcgacgcccataccgacaccaatgatgagatgttcgga
gagaaaatcgcccacggcaccaccttccgccgcgccgttgaggagggactgctcgacctc
aaacgggtggtgcagattggtcagcgcgcccagggctatgccgccggcgacttccagtgg
ggcgttgaccagggctttcgcctggtgcaggcggagcagtgctggcatacctcgctggcg
ccgctgatggccgaagtccgccagcagatgggcaacgggccggtgtatctcagctttgat
atcgacagcctcgatcccatctgggctccaggaaccgggacgccggaagttggcggtctg
agctccattcaggcgctggagatcgtccgcggctgccgcggcctgaacctgattggcgcc
gatctggtcgaggtctcgcccccctacgacgtgagcggtaatacctcccagctggcggcc
aacctgctgtacgagatgctctgcgtcctgcccggcgtgaagtacgcctga

DBGET integrated database retrieval system