KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03321Help
Entry
KPN_03321         CDS       T00566                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3641447..3642160)
Genome map
AA seq 237 aa AA seqDB search
MKKGLLMFTLLAASLSGAAHADSAAIKQSLAKLGVQSTDIQPSPVSGMSTVLTDSGVLYV
TDDGKHIIQGPMYDVSGAQPVNVTNQLLLGKLNALSNEMIVYKAPKEQHVITVFTDITCG
YCHKLHEQMSDYNALGITVRYLAFPRQGLQSQAEQDMKAIWCAKDRNKALDDAMNGKGVQ
PASCSVDIAKHYTLGVQMGVNGTPAMVLSNGMVLPGYQGPKELKAFLDEHKKQTSGN
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggtttattgatgttcaccctgctggcggcctccctttcaggagcggcgcac
gccgatagcgcggcaattaaacagtcgctggcgaagctgggtgtgcagagcaccgatatt
caaccatcgccggtttccgggatgagcacggtgctgaccgacagcggcgtgctgtacgtg
accgacgacggcaaacatatcatccaggggccgatgtacgacgtgagcggcgcgcagccg
gtcaacgtcaccaaccagctgctgctgggtaagctgaacgcgctgagcaatgagatgatt
gtctacaaagcgccgaaggagcagcacgtcatcaccgtcttcaccgatattacctgcggc
tactgtcataaactgcacgagcagatgagcgactacaacgcgctggggatcaccgtgcgc
tatctggctttcccgcgccagggtctgcaaagccaggcggagcaggacatgaaggccatc
tggtgcgcgaaagatcgcaacaaagcgctggatgacgccatgaatggtaaaggcgtgcag
ccggcgagctgcagcgtagatatcgccaaacattacaccctcggcgtgcagatgggcgtc
aacggtacgccggcgatggtcctcagtaacggcatggtgctgccgggctatcaggggccg
aaagagctgaaggcgttccttgatgagcacaaaaaacagacaagcggtaactga

DBGET integrated database retrieval system