KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03545Help
Entry
KPN_03545         CDS       T00566                                 

Gene name
fruA
Definition
PTS family enzyme IIB'BC, fructose-specific
Orthology
K02769  
PTS system, fructose-specific IIB component [EC:2.7.1.69]
K02770  
PTS system, fructose-specific IIC component
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Fructose and mannose metabolism
Metabolic pathways
Phosphotransferase system (PTS)
Module
PTS system, fructose-specific II component
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:kpn00051]
Environmental Information Processing; Membrane transport; Phosphotransferase system (PTS) [PATH:kpn02060]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3906956..3908368
Genome map
AA seq 470 aa AA seqDB search
MKKIIAVTGCPTGIAHTFMAEEALKTAAKKLNVEIKVETNGASGVENAITPEDLKDIYGV
IIAADKDVNAERFNGLPVIEVPVKEAIHHPAELINKVVNGQAPRRQGFSAATDPDEKYER
ESFGRQIYKHLMSGVSNMLPFVVAGGILIAVSFLWGIYSADPNSPQYNVIAATLMKVGQQ
AFSIMVPVFTAYIAWSISGRPGMVAGFVGGLLANATGAGFLGGIIAGFAAGYFMLLIRHL
LDGLPRQYEGLKSIFIMPLIGVLVIGVMMVLLGQPVAAINNGMMNWLSSLQEANPILLGI
VVGAMCSFDFGGPVNKAAYVTGTLLLGQGNYFFMAGVSAACITPPLVIALATTFFPKGFS
EEERAAGMVNYILGCTHITEGAIPFAAKDPLRVIPMMMIASSISAVLSYSLHIQVPAPHG
GFLILPLVSKPLMWVLCILAGSACGALMLGCWRLWQKRTDKATALAGAMK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgccgtgaccggctgccctacaggtattgctcatacatttatggct
gaagaggccttaaaaaccgcagcgaaaaaattaaacgttgaaataaaagtcgaaaccaat
ggcgcttccggcgtagaaaacgccattacgccggaagacctgaaggatatttatggcgtg
attatcgctgccgataaagatgttaatgccgaacgttttaatggtttaccggttattgag
gtgccggttaaagaagccattcatcatccggcggaattaattaataaagtcgttaacggt
caggcgccgcgtcgtcagggattctccgcggcaacggatccagacgagaaatatgagcga
gaatcgttcggccgacagatttacaaacatctgatgagcggcgtttccaacatgctaccg
ttcgttgtcgccggcgggatcttaatcgctgtatctttcttatggggcatctactccgcc
gacccgaattcaccgcagtataacgtgattgccgccacgctgatgaaagtcggtcagcag
gcgttctcgatcatggtgccggtgtttaccgcctacattgcctggtcgatatctggccgc
cctggcatggttgccggttttgtcggcggtctgctggcgaacgccaccggcgccgggttt
ctcggtgggatcatcgccggttttgccgccggatattttatgctgctgatccgtcatctg
ctcgacggtctgccgcgccagtacgaagggctgaagtcgatctttattatgccgctgatc
ggcgtcctggtgatcggcgtgatgatggttctgctcggccagccggtggcagcgatcaac
aatggcatgatgaactggctcagctctttacaggaagccaacccaatcctgctggggatc
gtggtaggcgcaatgtgctccttcgacttcggcgggccggtcaacaaagcggcctatgtc
accggtacgttgctgctgggtcaaggtaactacttctttatggccggtgtatctgccgcc
tgcatcacgccgccgctggtcatcgctctggcgaccacgttctttccgaaaggctttagc
gaggaggaacgcgccgccgggatggtcaactatatcctcggctgcacacacattaccgaa
ggtgcaattccctttgccgccaaggatccgctgcgggtgatcccgatgatgatgatcgcc
tcctcaatttctgcggtactcagctacagcctgcatattcaggttccggcaccgcacggc
ggcttcttaatcctgccgctggtcagtaaaccgttgatgtgggtgctgtgcattctcgcc
ggttccgcctgcggggcacttatgctgggatgctggcggctgtggcaaaaacgcactgac
aaagcgacagctcttgctggcgccatgaaataa

DBGET integrated database retrieval system