KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03587Help
Entry
KPN_03587         CDS       T00566                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:kpn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947638..3948486)
Genome map
AA seq 282 aa AA seqDB search
MKLVAQGSTLDLSHPHVMGILNVTPDSFSDGGAHNSLIEAVKHANLMINAGATIIDIGGE
STRPGAAEVSVEEELARVIPVVEAIAQRFEVWISVDTSKAEVIRQSARAGAHIINDIRSL
TEPGALQAAAETGLPVCLMHMQGQPKTMQEAPKYEDVFADVERFFNEHIVRCEQAGIAKE
KLLLDPGFGFGKNLSHNYQLLARLGEFHHFGLPLLVGMSRKSMVGQLLNVGPSERLNGSL
ACAVIAAMQGAQIIRVHDVKETVEALRVVEATLAAKGKKRYE
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtagcccagggctcaaccctcgatctctctcacccccacgtgatgggtatt
ctaaatgtgacgcctgactccttctccgatggcggcgcccataattcgctgattgaggcg
gtgaagcatgccaatctgatgatcaacgccggcgcgaccatcattgatatcggcggtgaa
tcgacgcggccaggggcggctgaggttagtgtggaagaggagcttgcgcgggtgataccg
gtggttgaagccattgcccagcgctttgaggtatggatctcagtggatacctccaaggcg
gaggttattcgccaatcggccagggccggggcgcatatcatcaacgatattcgttcgctg
accgagcccggcgcgctgcaggccgccgcggaaaccggactgccagtgtgtctgatgcat
atgcagggacaaccaaaaaccatgcaggaggcgccgaagtatgaggacgtcttcgccgat
gttgagcgtttttttaatgagcacattgtgcgctgcgaacaggcagggatcgcaaaagaa
aaattgctgctcgacccgggattcggtttcggtaaaaatctctcccacaattaccaactg
ttggccaggcttggggagtttcatcactttggtctgccgctgctggtcggtatgtcacgt
aagtcgatggtaggtcagttgctgaacgtcgggccgtcggagcggctgaacggcagcctg
gcgtgtgccgtcattgcagcaatgcagggcgcgcagattatccgcgtccatgatgtcaaa
gaaacggtagaagcgctgcgcgtggtggaagccaccctcgccgctaagggaaaaaaacgt
tatgagtaa

DBGET integrated database retrieval system