KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03599Help
Entry
KPN_03599         CDS       T00566                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:kpn00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:kpn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3958610..3959869)
Genome map
AA seq 419 aa AA seqDB search
MDKFRVQGPTRLQGEVTISGAKNAALPILFSALLAEEPVEIQNVPKLKDIDTTMKLLSQL
GAKVERNGSVWIDAGPVDVFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGAR
PVDLHISGLEQLGAEIKLEEGYVKASVSGRLKGAHIVMDKVSVGATVTIMSAATLAEGTT
IIENAAREPEIVDTANFLNALGAKITGQGSDRITIEGVQRLGGGVYRVLPDRIETGTFLV
AAAISGGKILCRNAQPDTLDAVLAKLRDAGADIETGEDWISLDMHGNRPKAVNVRTAPHP
GFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHIPELIRMGAHAEIESNTAICHGVKQL
SGAQVMATDLRASASLVLAGCIAEGTTIVDRIYHIDRGYERIEDKLQALGANIQRVKGE
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggataaattccgtgttcaggggccgactcgccttcagggtgaagtcaccatctccggg
gcaaaaaacgccgccctgccaatcctcttttccgcgctgcttgccgaagagccggtagag
atccaaaacgtacctaagctgaaagacatcgataccaccatgaagctgctgagccagctg
ggcgcgaaggtcgagcgcaatggttcggtatggattgacgccggcccggtcgatgtattc
tgtgctccgtacgatctggtgaaaaccatgcgcgcctctatctgggcgctgggcccgttg
gtggcgcgtttcggtcaggggcaagtttctctgcctggcggctgcgctatcggcgcgcgt
ccggtcgatctgcatattagcggtctggagcagctgggcgccgagatcaaactggaagaa
ggttatgtcaaagcctcggtcagcggtcgcctgaaaggcgcgcatattgtgatggataag
gtgagcgtcggcgccaccgtaaccatcatgagcgcagcgacgcttgcggagggaacgacg
attattgaaaacgccgctcgcgagccggagattgtcgataccgccaacttcctgaacgcg
ctgggcgcaaaaatcacaggccagggtagcgatcgcattaccatcgaaggcgtgcagcgc
ctgggcggcggcgtctaccgtgtgctgcctgaccgtattgaaaccgggactttcctggtg
gccgcggcgatttccggcggcaagatcctctgccgtaacgcgcagccggataccctggat
gccgtactggcgaagctgcgcgacgccggggctgacatcgaaacgggcgaagactggatc
agcctcgatatgcacggcaaccgtccgaaagcggtcaacgtgcgtaccgcgccgcacccg
ggcttcccgaccgatatgcaggcccagttcacgctgcttaacctggtagcggaagggacc
ggcgtgatcaccgaaacgatctttgaaaaccgcttcatgcacattccggagctgatccgt
atgggcgcgcacgcggagatcgagagcaataccgctatctgtcacggcgtgaagcagctt
tctggcgcgcaggtgatggcgaccgatttgcgcgcgtcggcgagcctggtgctggccggc
tgtatcgctgaagggaccaccatcgtcgatcgcatctatcatatcgatcgcggctatgag
cgtatcgaagataaactgcaggcgctgggcgccaatattcaacgcgtgaagggcgagtaa

DBGET integrated database retrieval system