KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03786Help
Entry
KPN_03786         CDS       T00566                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:kpn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4132152..4134245)
Genome map
AA seq 697 aa AA seqDB search
MESKRLDNAALAAGISPSYINAHGKPQSIAAVTKQRLLDAMHRSTAATKVAVNPLPNVKI
FTHGKKMSLPVAGRGEYQWILTTEDGKQYQGKTRGGETLPLPAKLPEGYHSLTLTQEGER
WHCRTIVAPARCYEPQPLKEGKKLWGTCVQLYTLRSEKNWGIGDFGDLRAMLPEIARRGG
SFIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFQRSEEAQAWWQSPATQQ
ALQAARETDDVDYTAVTTLKMTALRMAWKQFSRREDEQMAAFREFVLREGESLYWQAAFD
ALHAWQVQQDPLRWGWPAWPKAFQDIDSPEVKAFCVEHEDDVSFYLWLQWLAWSQFAACW
ETSQRDGMPIGLYRDLAVGVAEGGSETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMD
PHIIAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLL
SLLALESQRHRCMVIGEDLGTVPVEIVSKLRNSGVYSYKVLYFESDAEKTFRAPALYPEQ
SMAVATTHDLPTLRGYWESGDLTLGKALGLYPDEVVLRGLYQDRELAKQGLLDALHKYGC
LPKRAGHKASLMSMTGILNRGMQRYIADSNSALLGLQPEDWLEMATPVNIPGTSTEYPNW
RRKLSVTLEQMFADERVNKLIKDLDKRRKAASKKAAS
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgcctcgataatgccgcgctggcggcgggcatcagccccagctatatc
aacgcgcacggcaagccgcagtctatcgcggctgtcaccaaacagcgcctgctggatgcg
atgcatcgctctaccgccgccacgaaagtggcggttaacccgctgccgaacgtgaaaatt
ttcactcacggcaaaaaaatgtcgctgccggtggcaggacgcggtgagtatcagtggatc
ctgactactgaggatggtaagcagtatcaagggaaaacccgcggcggcgagacgctgccg
ctgccggccaaactgccggaggggtaccactccctgaccctcacccaggagggggagcgc
tggcactgccggactatcgtcgcgccagcccgctgctatgagccgcagccgctgaaagag
gggaaaaagctgtggggcacctgcgtgcagctgtataccctgcgctccgagaaaaactgg
gggatcggcgattttggcgatctgcgggccatgctgccggaaatcgcccgccgcggcggg
tcgtttattggccttaacccgattcatgccctctatccggcgaacccggagagcgccagc
ccctatagcccgtcttcacgtcgctggctgaacgttatttatatcgacgtcaacgcggtt
gaagatttccagcgtagcgaagaggcgcaggcgtggtggcagtctccggcaacgcagcag
gcactgcaggcggcgcgggaaacggacgacgtggattataccgccgtcactacgctgaaa
atgaccgcgctgcgtatggcgtggaaacaattctctcgtcgtgaagatgagcagatggca
gcgttccgcgagtttgttctgcgcgaaggggaaagcctctactggcaggcggctttcgat
gcgctgcacgcctggcaggtacaacaggacccgctgcgctggggctggccggcctggccg
aaggcctttcaggatatcgacagcccggaggtgaaagccttctgcgtcgagcatgaggat
gacgtcagtttctatctttggctgcagtggctggcctggagtcagtttgccgcctgctgg
gaaaccagccagcgtgacggcatgccgatcggcctctaccgcgacctggcggtgggcgtc
gccgagggcgggtcggaaacctggtgcgatcgtgaactgtactgcctgaaagcatccgta
ggcgcgccgccggatattctgggcccgctgggccagaactggggcctgccgccgatggat
ccgcatatcattgccgcccgcgcctatgagccgtttatcgacctgctgcgcgctaatatg
cagaactgcggcgcgttgcgcatcgatcacgtgatgtctgtgctgcgtctgtggtggatc
ccgtatggtgaaaccgccgaccatggcgcttacgttcagtatccggtcgacgatctgctg
tcgcttctggcgctggaaagccagcgtcatcgctgcatggtgatcggtgaagatctgggc
acggtaccggtggagatcgtcagcaagttacgcaacagcggcgtctattcttataaggtg
ctctattttgagagtgatgcagagaaaacgttccgcgcgccggcgctgtacccggagcaa
tcaatggctgtggcgacgacgcacgacctgcccactcttcgcggctactgggaaagcggc
gatctgacgttaggtaaagcgctgggcctctatcctgatgaggtggtgctgcgcggactg
taccaggaccgcgagctggcgaagcaagggctgctggacgcgctgcataagtacggctgt
ctgcccaagcgcgccggccataaggcctcgctgatgagcatgacggggatcctcaaccgg
gggatgcagcgttatattgccgacagcaacagcgccctgctgggcctgcagccggaagac
tggctggagatggcgacgccggttaacattccgggcaccagcaccgagtacccgaactgg
cgccggaagctgtccgtcaccctggagcagatgtttgccgatgaacgggtcaataagctg
attaaggatctggataaacggcgcaaggcggcgagcaagaaagccgcctcctga

DBGET integrated database retrieval system