KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03867Help
Entry
KPN_03867         CDS       T00566                                 

Definition
putative glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    KPN_03867
Enzymes [BR:kpn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     KPN_03867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4226393..4227037)
Genome map
AA seq 214 aa AA seqDB search
MAEESLTMLTILGKRSSINVRKVLWTCEEAGLAYQQEDYGSGFKPLDTPEFQRLNPNSLV
PVLLDDDFVLWESNSICRYLARKAERWDLLPAEPQPAAEVEHWMDWQATEFNTAWRHAFM
GLVRKDPRFQDPVAIKESIAAWTHCVRIVEAQLQRTGAWVAGERFTLADIVLGLSVHRWK
MTPFAHPEMPAVERWYMALNQRPAFMRHGNNGVA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaatcgctgacgatgctaacaattctgggtaaacgctcttcaattaatgta
cggaaagtgctgtggacctgcgaggaagccgggctggcgtaccagcaggaagattacggc
agcggatttaagcccctggatacgcctgagtttcagcgtctgaatcctaacagcctggtg
ccggtgctactggacgatgacttcgtgctctgggagtcgaacagtatctgccgctatctg
gcgcgcaaagcggagcgctgggatctgctgcccgccgagccgcagcccgccgccgaggtg
gagcactggatggactggcaggcgaccgagtttaacactgcctggcgccatgcttttatg
gggctggtgcgtaaagatccgcgctttcaggatccggtggcgattaaagagagtattgcc
gcctggacccactgcgtgcgcattgttgaagcgcagctgcagcgtaccggggcgtgggta
gccggcgagcgcttcaccctggccgatatcgtgctggggctgtcggtgcatcgctggaaa
atgacccctttcgcccatccggagatgccagccgtggagcgctggtatatggcgctcaat
cagcgcccggcgtttatgcgccatggcaataacggcgtggcctga

DBGET integrated database retrieval system