KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03867Help
Entry
KPN_03867         CDS       T00566                                 

Definition
putative glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:kpn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4226393..4227037)
Genome map
AA seq 214 aa AA seqDB search
MAEESLTMLTILGKRSSINVRKVLWTCEEAGLAYQQEDYGSGFKPLDTPEFQRLNPNSLV
PVLLDDDFVLWESNSICRYLARKAERWDLLPAEPQPAAEVEHWMDWQATEFNTAWRHAFM
GLVRKDPRFQDPVAIKESIAAWTHCVRIVEAQLQRTGAWVAGERFTLADIVLGLSVHRWK
MTPFAHPEMPAVERWYMALNQRPAFMRHGNNGVA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaatcgctgacgatgctaacaattctgggtaaacgctcttcaattaatgta
cggaaagtgctgtggacctgcgaggaagccgggctggcgtaccagcaggaagattacggc
agcggatttaagcccctggatacgcctgagtttcagcgtctgaatcctaacagcctggtg
ccggtgctactggacgatgacttcgtgctctgggagtcgaacagtatctgccgctatctg
gcgcgcaaagcggagcgctgggatctgctgcccgccgagccgcagcccgccgccgaggtg
gagcactggatggactggcaggcgaccgagtttaacactgcctggcgccatgcttttatg
gggctggtgcgtaaagatccgcgctttcaggatccggtggcgattaaagagagtattgcc
gcctggacccactgcgtgcgcattgttgaagcgcagctgcagcgtaccggggcgtgggta
gccggcgagcgcttcaccctggccgatatcgtgctggggctgtcggtgcatcgctggaaa
atgacccctttcgcccatccggagatgccagccgtggagcgctggtatatggcgctcaat
cagcgcccggcgtttatgcgccatggcaataacggcgtggcctga

DBGET integrated database retrieval system