KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03881Help
Entry
KPN_03881         CDS       T00566                                 

Gene name
bcsC
Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPN_03881 (bcsC)
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KPN_03881 (bcsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4247467..4248576)
Genome map
AA seq 369 aa AA seqDB search
MMKVLCGAVLSALLLAAGQVGAACQWPAWEQFKQAYVSPEGRVIDPSDARKISTSEGQSY
GLFFALAANDRAGFDKLLTWTQNNLAEGDLKQHLPGWLWGKKDDEQWTLLDSNSASDSDL
WIAWALLEAGRLWQQPQYTETGKALLARIVAEETVAVPGLGTMLLPGKVGFADDRGWRFN
PSYLPPQLATYFVRFGAPWPALRDSNLRLLLETAPKGFTPDWVRYEKGKGWQLKTEKPPI
GSYDAIRVYLWVGMLHDGDKQKARLLQRFAPMAAQTTEQGVPPEKVNIATGKTSGQGPVG
FSAAMLPFLQDDEARSVQRQRVADNYPGADAYYSAVLTLFGQGWDQHRFRFTASGELQPD
WNQECASSH
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagtactttgtggcgcggtgctctcggcgctgctgctggcggcgggccaggtg
ggcgccgcctgccagtggcccgcctgggagcagtttaaacaagcgtacgtcagccccgag
ggacgggtgattgaccccagcgatgcgcgcaaaatctccacctccgaagggcagagctat
ggcctgtttttcgccctggcggccaacgatcgcgcagggttcgacaaactgctgacctgg
acgcagaacaacctggcggaaggcgatctgaaacaacatttgccgggctggctgtggggc
aaaaaggacgatgagcagtggaccctgctggacagcaactcggcgtccgactcggatctg
tggatagcctgggcgctgctggaggcggggcgcctgtggcaacagccgcagtacaccgag
accggtaaagccctgctggcgcggattgtcgctgaagagacggtggcggtgccgggcctc
ggcacgatgctgctgccgggaaaagtcggttttgccgatgacagaggctggcggtttaac
cccagctatcttccgccgcagctggccacctactttgtgcgttttggcgcgccgtggccc
gctctgcgcgacagtaacctgcgcctgctgctggagaccgcgccgaaaggctttaccccg
gactgggtgcgctatgagaaagggaaaggctggcagctgaaaaccgaaaagccgccgatc
ggcagctatgacgcgattcgcgtctacctgtgggtgggcatgctccatgatggcgataag
cagaaagcgcgtctgctgcaacgcttcgcgccgatggcggcgcagaccacggagcagggg
gtacccccggagaaagtgaatatcgccaccggcaaaaccagcggccaggggccagtgggc
ttctccgcggcaatgctgccgtttttacaggacgacgaggctcggtcggtgcaacgccag
cgcgtcgccgataactatcccggcgcggatgcctactacagcgcagttctgacgctgttc
ggccagggttgggatcaacaccgttttcgtttcacggcgagtggcgaattacaacctgac
tggaaccaggaatgcgcaagctctcactaa

DBGET integrated database retrieval system