KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03889Help
Entry
KPN_03889         CDS       T00566                                 

Definition
(GenBank) endo-1,4-D-glucanase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Brite
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     KPN_03889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4258185..4259186)
Genome map
AA seq 333 aa AA seqDB search
MPLRALVAMIVTTVVMLVPRAWADTAWERYKARFMMPDGRIIDTANGNVSHTEGQGFAML
LAVANNDRPAFDKLWQWTDNTLRNKSNGLFYWRYNPVAPDPIADKNNASDGDTLIAWALL
RAQKQWQDKRYAIASDAITAALLKSTVVSFAGRQVMLPGVKGFNLNDHLNLNPSYFIFPA
WRAFAERTHLTAWRTLQSDGQALLGQMGWGKSHLPSDWVALRADGKMLPAKEWPPRMSFD
AIRIPLYLSWADPHSALLAPWKAWMQSYPRLQTPAWINVSTNEVAPWYMAGGLLAVRDLT
LGEPQEAPQIDDKDDYYSASLKLLVWLAKQDQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgcgtgctttagtggcgatgatagtgacaacggtagtgatgctggtgcccagg
gcgtgggcggatacggcctgggagcgctataaggcccgttttatgatgccggatggtcgt
atcattgatacagctaatggcaatgtgtcgcatacggaaggtcagggcttcgccatgctc
ctggcggtggcgaataacgatcgtccggcgttcgacaagctgtggcagtggacggacaac
accctgcgcaacaagtctaacgggctgttttactggcgctataacccggtggcgccggac
cctatcgccgataaaaacaacgcctccgatggcgataccctgatcgcctgggcgctgcta
cgcgcgcaaaagcagtggcaggataagcgctatgcgattgcctctgacgccatcaccgcc
gccctgctgaagtctacggtggtgtctttcgccggtcgccaggtaatgctcccgggtgtg
aaagggttcaacctcaatgatcacctgaaccttaacccttcctatttcatcttcccggcc
tggcgcgccttcgcggagcggacgcatctcaccgcctggcggacattgcagagcgacgga
caggcgctgctggggcagatgggctgggggaaatcacatctacccagcgactgggtggcg
ctgcgggcggatggcaagatgctgccagccaaagagtggccgccgcggatgagtttcgat
gcgatccgtatcccgctgtatctctcgtgggccgatccgcacagcgccttgctcgcgccc
tggaaggcctggatgcagagttacccgcgcctgcaaaccccggcgtggatcaacgtcagc
accaacgaggtggctccctggtatatggccggcggcctgctggcggtgcgcgatctgacg
ctgggtgaaccgcaggaggcgccgcagattgacgacaaggatgattattactctgccagc
ctcaagctgttggtctggctggcgaaacaggatcagcgctaa

DBGET integrated database retrieval system