KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03929Help
Entry
KPN_03929         CDS       T00566                                 

Gene name
xylA
Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    KPN_03929 (xylA)
   00051 Fructose and mannose metabolism
    KPN_03929 (xylA)
Enzymes [BR:kpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     KPN_03929 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4306798..4308132)
Genome map
AA seq 444 aa AA seqDB search
MEFSMQTYFDQLDRVRYEGPKSTNPLAFRHYNPDELVLGKRMEDHLRFAACYWHTFCWNG
ADMFGVGSFDRPWQQPGDALEMAKRKADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYS
NNFARMVEVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNA
THQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQLVVEHKHKIGFKGTLLIEPKPQ
EPTKHQYDYDASTVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVD
ANRGDPQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGH
IGAMDTMALSLKVAARMIEDGELDKRVARRYAGWNGELGQQILNGQMTLSDIAQYAAQHQ
LAPQHRSGQQEQLENLVNHYLFDK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggagttctctatgcagacctatttcgatcaactcgatcgcgttcgttacgaaggcccg
aaatccactaacccgctggctttccgtcattacaacccggatgaactggtgctgggcaaa
cggatggaagatcatctgcgttttgcggcctgttactggcacaccttctgctggaatggc
gccgatatgtttggcgtgggctcctttgatcgtccctggcagcagcctggcgacgccctg
gagatggccaaacgcaaagccgatgtggcgttcgaattcttccataaactcaacgtgcct
tactactgcttccacgacgttgacgtctcgccggaaggcgcttcgctcaaggagtacagc
aataacttcgcccggatggtcgaggtgctggctgagaaacagcagcagagcggcgtgaag
cttctgtgggggaccgcaaactgctttaccaacccgcgctacggcgccggcgcggccacc
aacccggatccggaagtatttagctgggcggccacccaggtggtcaccgccatgaatgcc
acccatcaactgggcggtgaaaactatgtgctgtggggcggtcgcgagggctatgaaacc
ctgctgaataccgacctgcgccaggagcgtgagcagattggccgctttatgcagctggtg
gtggagcataagcataaaatcggctttaaaggcacgctgctgattgagcccaaaccgcag
gagccgaccaagcatcagtatgactatgatgcctctaccgtttacggcttcctcaaacag
tttggtctggaaaaagagattaaactgaatattgaagctaaccatgccacgctcgccggc
cattcgttccatcatgaaattgcgacggccattgcgctggggctgttcggctccgttgac
gccaaccgcggcgatccgcagctgggctgggataccgaccagttcccgaacagcgtcgaa
gagaacgcgctggtgatgtatgaaatcctcaaagcgggcggcttcaccaccggcgggctc
aactttgatgcgaaagtgcgccggcagagcaccgacaaatacgatctgttctatggtcat
attggcgcgatggataccatggcgctgtcgctgaaggtcgcggcgcggatgatcgaggac
ggcgaactggataagcgcgtggccagacgctacgccggctggaacggtgagctggggcag
cagatccttaacgggcagatgaccctgagcgatattgcccagtatgccgctcagcatcag
ctggcgccgcagcatcgcagcggccagcaggaacaactggaaaacctggtcaaccattat
ctgtttgacaagtaa

DBGET integrated database retrieval system