KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_03996Help
Entry
KPN_03996         CDS       T00566                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00230  Purine metabolism
kpn01100  Metabolic pathways
Module
kpn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KPN_03996 (gmk)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     KPN_03996 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_33 MMR_HSR1 AAA_22 ABC_tran AAA_18 AAA Viral_helicase1 CPT AAA_29
Motif
Other DBs
NCBI-ProteinID: ABR79381
UniProt: A6TFP7
Position
4378161..4378784
Genome map
AA seq 207 aa AA seqDB search
MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRAPRPGEVHGEHYFFVNHD
EFRSMIGENAFLEHAEVFGNYYGTSRKAIEQVLATGVDVFLDIDWQGAQQIRKSMPGARS
IFILPPSKDELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALSDLK
NIIRAERLRMSRQKQRHGALITKLLAD
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaggcacgctttatattgtttccgcccctagcggcgcgggtaaatccagcctg
attcaggctttattaaaaacccaaccgttgtatgacacccaggtatcggtctcccatacc
acgcgggcgccgcgtccgggtgaagtgcacggcgaacactatttcttcgtgaatcacgac
gaattccgctcgatgattggcgaaaacgcgtttctggaacatgcagaggtctttggcaac
tattacggcacgtcgcgtaaagcgatcgagcaggtgctggcgaccggcgtcgatgtcttc
ctcgatatcgactggcaaggcgcgcagcagatccgtaaaagcatgcccggcgcgcgcagt
atttttattctgccgccgtcaaaagatgaactggaccgtcgcctgcgcggccgcggccag
gacagcgaagaggtgatcgcgaaacggatggcccaggccgttgcggaaatgagccattac
gcggaatatgattacctgattgtgaacgatgattttgacaccgccctgagcgacctgaaa
aatatcatccgcgctgaacgtctgcgcatgagccgccaaaagcagcgacatggcgcttta
atcaccaaactattggcagactga

DBGET integrated database retrieval system