KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04005Help
Entry
KPN_04005         CDS       T00566                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00010  Glycolysis / Gluconeogenesis
kpn00051  Fructose and mannose metabolism
kpn00562  Inositol phosphate metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
kpn01230  Biosynthesis of amino acids
Module
kpn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpn_M00002  Glycolysis, core module involving three-carbon compounds
kpn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_04005 (tpiA)
   00051 Fructose and mannose metabolism
    KPN_04005 (tpiA)
   00562 Inositol phosphate metabolism
    KPN_04005 (tpiA)
Enzymes [BR:kpn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     KPN_04005 (tpiA)
Exosome [BR:kpn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   KPN_04005 (tpiA)
  Exosomal proteins of bladder cancer cells
   KPN_04005 (tpiA)
  Exosomal proteins of melanoma cells
   KPN_04005 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM DUF3254
Motif
Other DBs
NCBI-ProteinID: ABR79390
UniProt: A6TFQ6
Position
4387262..4388011
Genome map
AA seq 249 aa AA seqDB search
MGNWKLNGSRHMVNELVANLRTELAGVSGCAVAIAPPEMYLDLAKRAAEGSHIHLGAQNV
DVNLSGAFTGETSAEMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQGLTPVLC
IGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATPAQAQAV
HKFIRDHIAKADAKIAEQVIIQYGGSVNAGNAAELFTQPDIDGALVGGASLKADAFAVIV
KAAEAAKKA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactggaaactgaacggcagccgccacatggtaaacgaactggttgcgaacctg
cgtaccgagctggctggcgtaagcggctgtgcagttgccatcgccccgccggaaatgtat
ctggacctggctaagcgcgcggcagaaggcagccacattcacctgggcgcgcagaacgtt
gacgtgaacctgtccggcgcattcaccggtgaaacctccgccgaaatgctgaaagatatc
ggcgcgcagtacatcatcatcggccactccgagcgtcgtacctaccacaaagaatccgac
gagctgatcgcgaagaaattcgccgtgctgaaagagcagggtctgaccccggttctgtgc
atcggtgaaaccgaagccgaaaacgaagcgggcaaaacggaagaagtttgcgcgcgtcag
atcgacgccgtgctgaaaacccagggcgctgccgctttcgaaggcgtggttatcgcttac
gaaccagtatgggctatcggtaccggcaaatcagcgaccccggctcaggcgcaggcggtg
cacaaattcatccgtgaccacattgctaaagctgacgccaaaatcgctgagcaagtgatc
atccagtacggcggttccgttaacgctggcaacgccgcagagctgttcacccagccggac
atcgacggcgcgctggttggcggcgcctccctgaaagctgacgctttcgcggtgatcgtt
aaagcagcagaagcagcgaaaaaagcgtaa

DBGET integrated database retrieval system