KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04203Help
Entry
KPN_04203         CDS       T00566                                 

Definition
putative glycoprotein
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:kpn00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:kpn00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:kpn00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4601415..4603538
Genome map
AA seq 707 aa AA seqDB search
MSDSLIHLQSAGADIVIKTRPFAEIVYWGPHLSHFSPQDADSLMRPVANGRLDVDSPVTL
MAELGHGLFGAPGIEGHRQGLDASPLFTTSEVRHEGQTLTLVSEDPQAGLRLQSEIALDA
SGVLSVRHGVTNLRASPWQVDRLAVTLPVAERAREVMAFHGRWIREFQPHRLTLEHDSFV
LENRRGRTSHEHFPALITGSRAFSEMQGEVWGVHLAWSGNHRLRAEVKTDGRRYLQAEAL
YLPGEMALAEGETLWTPYLYASYSANGLNGMSQQFHRYLRERIIRFPGNKPRPVHLNTWE
GIYFDHDPDYIMRMADEAAALGVERFIIDDGWFKGRNDDWAALGDWYLDEKKYPYGLTPV
IDHVKSLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYTPLTGRHQFVLNLNIPEAFD
YLLERMSWLLGEHAVDYVKWDMNRELVQPGHQGRAAADAQTRQFYRLLDTLVARFPHIEF
ESCSSGGGRIDYEVLKRSHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGNRHCHAT
FRQHSIAFRGLTALFGHMGLELDPVSADEEERAGYRKYAALHKQWRDVIHHGVQWRIDMP
DATTLAHGVVSPDKAQAIFLVSQLAMPDYTLMAPLRLAGLEASARYQLTLLDHPNIQITG
EGGHTMRKLPAWMTTPQTVSGEWLQQAGLALPILDPESAILIGLQRV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgtctgattcgctgattcacctgcaaagcgccggtgccgatattgtaattaaaacccgc
cctttcgccgaaattgtctactggggaccgcatttaagccacttttcgccgcaggatgcc
gacagcctgatgcgcccggtcgccaacggtagactggatgtcgattcgccagtgacctta
atggcggagctgggccatggtctgtttggcgcgccgggcattgaaggccatcgtcagggg
ctggatgcctctccgctgttcaccaccagcgaagtgcggcacgagggccagacgctgacc
ctggtcagcgaagatccgcaggccggcctgcgcctgcagagcgagatcgcgttggatgcc
agcggcgtgctgagcgtgcgccatggcgtgaccaatctgcgcgccagcccatggcaggtg
gatcgcctggcggtcacgctgccggtcgccgaacgcgctcgcgaggtgatggctttccat
ggccgctggatccgcgagtttcagcctcaccgcctgacgctggagcacgacagctttgtg
ctggagaaccgccgcgggcgcacctctcacgaacatttcccggctctgatcaccggcagc
cgcgcctttagcgagatgcagggtgaagtctggggcgtgcatctggcctggagcggtaac
catcgcctgcgggcggaggtgaaaaccgatggccgtcgctatctgcaggccgaggcgctc
tatctgccgggcgaaatggcgctggcggaaggggaaaccttgtggacgccgtacctgtat
gccagctactcggcgaatgggctgaacggcatgagccagcagttccatcgttatctgcgc
gaacggattattcgtttcccgggcaacaaaccgcgcccggtgcatctcaacacctgggag
gggatctatttcgaccacgacccggactacatcatgcgtatggccgacgaagcggcggcc
ctgggcgtcgagcgctttattatcgatgacggctggtttaaagggcgcaacgacgactgg
gcggcgcttggcgactggtatctcgatgagaaaaaatacccctacggcctgacgccggtt
atcgatcacgtgaagtctctgggtatggaattcggtatctgggtggagccggaaatgatt
aacccggattccgatctgtaccgggcgcacccggactgggtgctggcgctgccgggctat
accccgctgaccggccgccatcagtttgtcctgaacctcaacattcccgaagcgtttgat
tatctgctggagcggatgagctggctgctgggcgagcatgcggtggactacgtgaagtgg
gatatgaaccgcgagctggtgcagcctgggcatcagggacgcgccgctgcagacgcgcaa
acgcgccagttttaccgcctgctggatacgctggtggcccgtttcccgcacattgaattt
gaatcctgctcctccggcggcggacggatcgattatgaagtcctcaaacgcagccatcgc
ttctgggcgtctgacaacaatgacgcccttgagcgcaacaccatccagcgcggcatgagc
tacttctttccacccgaggtaatgggcgcgcacattggcaatcgccactgtcatgccacc
ttccgccagcatagtatcgccttccgcggcctgacggcgctgttcggtcatatgggcctt
gagctggatccggtgagcgccgatgaagaagagcgcgccggataccgaaaatatgcagcc
ctgcataaacagtggcgcgacgtgatccatcacggcgtgcagtggcgaatagatatgccg
gacgccaccactcttgcccatggcgtcgtcagcccggataaagcgcaggcgatcttcctc
gttagccagctggcgatgccggactacaccctgatggcgccgctgcgcctggcgggcctg
gaggcgagcgcccgctatcagttgacgctcctcgatcatccgaacattcagatcaccggt
gagggcggccacaccatgcggaagctaccggcatggatgacgacgccgcagacggtgagc
ggtgagtggctgcagcaggcggggctggcgctgcccatcctcgacccggaaagcgccatt
ctgattggtctgcaacgcgtgtga

DBGET integrated database retrieval system