KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04206Help
Entry
KPN_04206         CDS       T00566                                 

Definition
(GenBank) putative alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00010  Glycolysis / Gluconeogenesis
kpn00071  Fatty acid degradation
kpn00350  Tyrosine metabolism
kpn00625  Chloroalkane and chloroalkene degradation
kpn00626  Naphthalene degradation
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_04206
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_04206
  Amino acid metabolism
   00350 Tyrosine metabolism
    KPN_04206
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPN_04206
   00626 Naphthalene degradation
    KPN_04206
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPN_04206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABR79585
UniProt: A6TGA1
Position
complement(4605194..4606333)
Genome map
AA seq 379 aa AA seqDB search
MLALPKISLHGAGAIGDMVKLVAGKQWGKALIVTDGQLVKLGLLDSLFAALDEQQMAYQL
FDEVFPNPTEALVQQGYAAYQAARCDYLIAFGGGSPIDTAKAIKILTANPGSSTAYSGVG
KVKNAGVPLVAINTTAGTAAEMTSNAVIIDSERQVKEVIIDPNLIPDIAVDDASVMLDIP
PAVTAATGMDALTHAIEAFVSVGAHPLTDANALEAIRLINLWLPKAVDDGHDLQAREQMA
FGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFARVA
QAMGVDTRGMSDEAASMEAINAIRTLSKRVGIPQGFSQLGVRKADIEGWLDKALADPCAP
CNPRPASRDEVRELYLEAL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttggcactacctaaaatcagcctccacggcgcaggcgcgatcggtgatatggtcaag
ctggtagcgggcaaacagtggggcaaggcgctgatcgtcaccgacggtcagctggtgaag
ctgggcctgctggacagcctgttcgccgcgctggatgaacagcagatggcttatcagcta
tttgacgaggtattccccaaccccaccgaagcgctggtgcagcaaggctatgcggcttac
caggcggcccgctgcgattacctgatcgccttcggcggcggtagcccgattgataccgcc
aaagcgataaaaatcctcaccgcaaacccaggctcctccaccgcctactccggcgtcggc
aaagtgaaaaacgctggcgtgccgctggtggccatcaacaccaccgccggcacggcggcg
gagatgaccagcaacgcggtaattatcgatagcgagcggcaggtgaaagaggtgattatc
gacccgaacctgatcccggatatcgccgtcgacgacgccagcgtgatgctcgacattccg
ccagccgttaccgccgccaccggcatggatgccctgacccacgccatcgaggcctttgtc
tccgttggcgcccatcccctgaccgacgccaacgccctcgaggccattcgtctgattaac
ctgtggctgccgaaagcggtagacgatgggcacgatctgcaggcccgcgagcagatggcc
tttggccagtatctggcgggcatggcgttcaacagcgccggtctcgggctggtacatgcc
ctggcccatcagcctggcgccacccataatctgccgcacggggtatgcaacgccatcctg
ctgccgatcatcgaaaactttaaccgcccgaacgcggtggcgcgctttgcccgcgtggcg
caggcgatgggcgtcgatactcgcggcatgagcgatgaagctgccagcatggaggccatc
aatgccatccgcacgctgagcaaacgcgtagggatcccccagggttttagccagcttggc
gtcagaaaagccgatatcgaaggctggctggataaagcgctggccgacccatgcgcgccg
tgtaacccgcgccccgccagccgcgatgaggttcgcgagctctatctggaggccttatga

DBGET integrated database retrieval system