KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04223Help
Entry
KPN_04223         CDS       T00566                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00010  Glycolysis / Gluconeogenesis
kpn00030  Pentose phosphate pathway
kpn00051  Fructose and mannose metabolism
kpn00052  Galactose metabolism
kpn00680  Methane metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
kpn01120  Microbial metabolism in diverse environments
kpn01130  Biosynthesis of antibiotics
kpn01200  Carbon metabolism
kpn01230  Biosynthesis of amino acids
kpn03018  RNA degradation
Module
kpn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
kpn_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_04223 (pfkA)
   00030 Pentose phosphate pathway
    KPN_04223 (pfkA)
   00051 Fructose and mannose metabolism
    KPN_04223 (pfkA)
   00052 Galactose metabolism
    KPN_04223 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KPN_04223 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KPN_04223 (pfkA)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPN_04223 (pfkA)
Protein phosphatases and associated proteins [BR:kpn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPN_04223 (pfkA)
Messenger RNA biogenesis [BR:kpn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     KPN_04223 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABR79602
UniProt: A6TGB8
Position
4623700..4624662
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELASYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKNDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgcgccgggcatgaacgcagca
attcgtggcgttgtgcgcgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggattgtatgaagaccgtatggttcagctcgaccgttacagcgtttccgac
atgatcaaccgcggcggtaccttcctgggctccgctcgcttcccggaattccgcgaagaa
cacatccgcgctgtggctatcgaaaacatgaagaagcgcggcctggacgcgctggtggtt
atcggcggtgacggttcctatatgggggcgatgcgcctgaccgagatgggcttcccatgc
atcggcctgccgggcactatcgacaacgatatcaaaggcactgactacaccatcggcttc
tttactgccctgagcaccgtggtggaagcgattgaccgtttgcgcgacacctcctcttcg
caccagcgtatctccgtggtggaagtgatgggccgttactgtggcgacctgaccctggcg
gcggcgattgccggcggctgtgagttcatcatggtgcctgaagtggaatatacccgtgac
gatctggtggcagaaatcaaagccggtatcgcgaaagggaaaaaacacgctatcgtggcc
atcaccgagcacatgtgcgacgttgacgagctggcaagctatatcgagaaagagactggc
cgtgaaactcgcgccaccgtcctcggccacattcagcgcggcggttccccggttccttac
gaccgcatcctggcttcccgcatgggcgcctatgcgattgagctgctgctgcagggccat
ggcggccgttgcgtcggcatccagaacgagaagctggtgcaccacgacatcatcgatgcc
atcgagaacatgaagcgtccgttcaagaacgactggctggattgcgcgaagaaactgtac
taa

DBGET integrated database retrieval system