KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04223Help
Entry
KPN_04223         CDS       T00566                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN_04223 (pfkA)
   01230 Biosynthesis of amino acids
    KPN_04223 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPN_04223 (pfkA)
   00030 Pentose phosphate pathway
    KPN_04223 (pfkA)
   00051 Fructose and mannose metabolism
    KPN_04223 (pfkA)
   00052 Galactose metabolism
    KPN_04223 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    KPN_04223 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    KPN_04223 (pfkA)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KPN_04223 (pfkA)
Protein phosphatases and associated proteins [BR:kpn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     KPN_04223 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4623700..4624662
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVFGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFREEHIRAVAIENMKKRGLDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFIMVPEVEYTRDDLVAEIKAGIAKGKKHAIVAITEHMCDVDELASYIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIELLLQGHGGRCVGIQNEKLVHHDIIDA
IENMKRPFKNDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagtggcggtgatgcgccgggcatgaacgcagca
attcgtggcgttgtgcgcgcggcattaacggaaggtctggaagtttttggaatctatgac
ggttacctcggattgtatgaagaccgtatggttcagctcgaccgttacagcgtttccgac
atgatcaaccgcggcggtaccttcctgggctccgctcgcttcccggaattccgcgaagaa
cacatccgcgctgtggctatcgaaaacatgaagaagcgcggcctggacgcgctggtggtt
atcggcggtgacggttcctatatgggggcgatgcgcctgaccgagatgggcttcccatgc
atcggcctgccgggcactatcgacaacgatatcaaaggcactgactacaccatcggcttc
tttactgccctgagcaccgtggtggaagcgattgaccgtttgcgcgacacctcctcttcg
caccagcgtatctccgtggtggaagtgatgggccgttactgtggcgacctgaccctggcg
gcggcgattgccggcggctgtgagttcatcatggtgcctgaagtggaatatacccgtgac
gatctggtggcagaaatcaaagccggtatcgcgaaagggaaaaaacacgctatcgtggcc
atcaccgagcacatgtgcgacgttgacgagctggcaagctatatcgagaaagagactggc
cgtgaaactcgcgccaccgtcctcggccacattcagcgcggcggttccccggttccttac
gaccgcatcctggcttcccgcatgggcgcctatgcgattgagctgctgctgcagggccat
ggcggccgttgcgtcggcatccagaacgagaagctggtgcaccacgacatcatcgatgcc
atcgagaacatgaagcgtccgttcaagaacgactggctggattgcgcgaagaaactgtac
taa

DBGET integrated database retrieval system