KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04316Help
Entry
KPN_04316         CDS       T00566                                 

Gene name
pldA
Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:kpn00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:kpn00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:kpn00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:kpn00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4723730..4724590
Genome map
AA seq 286 aa AA seqDB search
MRISLACLVALCALPAGVMAQDASVHDKPAVRGSIIANLLQDHDNPFLLYPYESNYLLYT
WTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGDNSLLGASYTQKSWWQLSNS
KESAPFRETNYEPQLFLGFATDYQFAGWTLRDIEMGYNHDSNGRSDPTSRSWNRLYARLM
AQNGNWLVEVKPWYVVGNTDDNPDITKYMGYYRLKVGYQLGEAILSAQGQYNWNTGYGGA
ELGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRVGVGLMLNDLF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttggcctgcctggtggcgctgtgcgcgctaccggccggtgttatggcg
caggacgcgtcggtacacgacaaaccggcagtgcgcggcagcattatcgccaacctgctc
caggaccatgataatcctttcctgctctacccttatgagagcaactatctgctctatacg
tggaccagcgacctcaataaagaggcgatccgcagctatgactgggccgaaaatgcccgt
aaagatgaagtgaagtttcagctaagcctggcgttcccgctgtggcgcggtatcctgggc
gataattcgctgctgggcgcgtcctatacccagaaatcctggtggcagctctctaacagc
aaagagtcggcgccgtttcgcgaaaccaattatgaaccccagctgtttttgggctttgcg
accgactaccagtttgccggctggacgctgcgcgatatcgagatggggtataaccacgac
tcgaatgggcgttccgaccccacctcgcgcagctggaatcggctttatgcccgcctgatg
gcgcaaaacggtaactggctggtggaagtgaagccctggtatgtggtgggcaacaccgat
gataacccggatatcaccaaatatatgggctattaccggctgaaggtgggctaccagctg
ggagaggcgatcctcagcgcgcaggggcaatacaactggaacaccggctacggcggggcg
gaacttggcgtgagctatcccattaccaaacatgttcgcgcctatacgcagatctacagc
ggctatggcgagtcgcttatcgactataactttaaccaaacgcgcgtcggcgtcgggcta
atgctcaacgatctgttttaa

DBGET integrated database retrieval system