KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04316Help
Entry
KPN_04316         CDS       T00566                                 

Gene name
pldA
Definition
(GenBank) outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00564  Glycerophospholipid metabolism
kpn00565  Ether lipid metabolism
kpn00590  Arachidonic acid metabolism
kpn00592  alpha-Linolenic acid metabolism
kpn01100  Metabolic pathways
kpn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPN_04316 (pldA)
   00565 Ether lipid metabolism
    KPN_04316 (pldA)
   00590 Arachidonic acid metabolism
    KPN_04316 (pldA)
   00591 Linoleic acid metabolism
    KPN_04316 (pldA)
   00592 alpha-Linolenic acid metabolism
    KPN_04316 (pldA)
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     KPN_04316 (pldA)
    3.1.1.32  phospholipase A1
     KPN_04316 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: ABR79684
UniProt: A6TGK0
Position
4723730..4724590
Genome map
AA seq 286 aa AA seqDB search
MRISLACLVALCALPAGVMAQDASVHDKPAVRGSIIANLLQDHDNPFLLYPYESNYLLYT
WTSDLNKEAIRSYDWAENARKDEVKFQLSLAFPLWRGILGDNSLLGASYTQKSWWQLSNS
KESAPFRETNYEPQLFLGFATDYQFAGWTLRDIEMGYNHDSNGRSDPTSRSWNRLYARLM
AQNGNWLVEVKPWYVVGNTDDNPDITKYMGYYRLKVGYQLGEAILSAQGQYNWNTGYGGA
ELGVSYPITKHVRAYTQIYSGYGESLIDYNFNQTRVGVGLMLNDLF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatctctttggcctgcctggtggcgctgtgcgcgctaccggccggtgttatggcg
caggacgcgtcggtacacgacaaaccggcagtgcgcggcagcattatcgccaacctgctc
caggaccatgataatcctttcctgctctacccttatgagagcaactatctgctctatacg
tggaccagcgacctcaataaagaggcgatccgcagctatgactgggccgaaaatgcccgt
aaagatgaagtgaagtttcagctaagcctggcgttcccgctgtggcgcggtatcctgggc
gataattcgctgctgggcgcgtcctatacccagaaatcctggtggcagctctctaacagc
aaagagtcggcgccgtttcgcgaaaccaattatgaaccccagctgtttttgggctttgcg
accgactaccagtttgccggctggacgctgcgcgatatcgagatggggtataaccacgac
tcgaatgggcgttccgaccccacctcgcgcagctggaatcggctttatgcccgcctgatg
gcgcaaaacggtaactggctggtggaagtgaagccctggtatgtggtgggcaacaccgat
gataacccggatatcaccaaatatatgggctattaccggctgaaggtgggctaccagctg
ggagaggcgatcctcagcgcgcaggggcaatacaactggaacaccggctacggcggggcg
gaacttggcgtgagctatcccattaccaaacatgttcgcgcctatacgcagatctacagc
ggctatggcgagtcgcttatcgactataactttaaccaaacgcgcgtcggcgtcgggcta
atgctcaacgatctgttttaa

DBGET integrated database retrieval system