KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04321Help
Entry
KPN_04321         CDS       T00566                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPN_04321 (pldB)
Enzymes [BR:kpn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     KPN_04321 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4729012..4730004
Genome map
AA seq 330 aa AA seqDB search
MFGQKKDWETRENAFAAFSMGPLTDFWRQREEAEFKGVDDVPVRFVRFCAQHNDRLVLIC
PGRIESYVKYAEVAYDLFHCGFDVMIIDHRGQGRSGRLLSDTHRGHVVNFSDYVDDLAAL
WQQQVVPGHWRKRFILAHSMGGAIATLFLQRYRAHCDAIALCAPMFGIIIRLPDWMVRHI
LDWAEGHQRIREEYAIGTGRWRALPFAVNVLTHSRQRYRRNLRFYADEPRLQVGGPTWHW
VREGMLAGDEVLANVEKDTAPTLLLQAEEERVVDNLMHDRYCELRAAAGHPCEGGKPLVI
EGAYHEILFEKDAMRSVALNAIVEFFNRHT
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggcagaaaaaggactgggaaacacgagaaaacgcgtttgcggcctttagcatg
gggccgctgacggatttctggcgacagcgcgaagaagctgaatttaaaggcgtcgacgat
gtaccggtacgctttgtccgcttttgcgcgcaacataacgatcgtctggtgttgatttgc
cccgggcgcattgaaagctacgtgaagtatgctgaagtggcctacgatctctttcactgc
ggctttgacgtgatgatcattgaccatcgcgggcagggacgctcgggccgcctgctctca
gatacccaccgcggacacgtggttaacttcagcgactatgttgatgacctggccgcgctc
tggcagcagcaggtggttcctggacactggcgaaaacggtttatccttgctcattctatg
ggcggagcgattgccacgctttttctgcaacgttaccgggcgcattgcgatgcaatagcg
ctctgcgcgccgatgttcgggattatcattcggctgccggactggatggtgcgccatatt
ctcgactgggctgagggccatcagcgcattcgcgaagagtatgccatcggcaccgggcgc
tggcgggcgctgccttttgccgttaacgtgctgacgcacagtcggcaacgctatcgtcgc
aacctgcgcttctatgccgatgagccgcggctgcaggtcggcggtccgacctggcactgg
gtgcgtgagggcatgctggccggcgacgaagtgctggcgaatgtggaaaaagataccgcc
ccgacgctgcttttacaggcggaagaggagcgggtggtcgataatctgatgcacgaccgc
tattgcgaattacgggccgctgccggccatccctgtgagggcggtaagccgctcgtcatt
gaaggggcatatcatgagatcctttttgaaaaggacgctatgcgctcagtcgcgctcaat
gccatcgtcgagtttttcaatcgacatacttaa

DBGET integrated database retrieval system