KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04340Help
Entry
KPN_04340         CDS       T00566                                 

Gene name
fadB
Definition
multifunctional fatty acid oxidation complex subunit alpha
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN_04340 (fadB)
   01212 Fatty acid metabolism
    KPN_04340 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPN_04340 (fadB)
   00650 Butanoate metabolism
    KPN_04340 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KPN_04340 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KPN_04340 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPN_04340 (fadB)
   00310 Lysine degradation
    KPN_04340 (fadB)
   00380 Tryptophan metabolism
    KPN_04340 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPN_04340 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KPN_04340 (fadB)
   00281 Geraniol degradation
    KPN_04340 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    KPN_04340 (fadB)
Enzymes [BR:kpn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KPN_04340 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KPN_04340 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KPN_04340 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     KPN_04340 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4748470..4750659)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEKQSDLKGLLLRSE
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIAAGKDVGADQALK
IGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARALVGIFLNDQYVK
AKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKKAVLAETESKVRP
DTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEKTSDNTIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKDDSKGKP
KKEEDAAVDSLLADVSQPKRDFSDEEIIARMMIPMVNEVVRCLEEGIIASPAEADMALVY
GLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKARHNEAYYPQVEPA
RPVGALKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggttcggtcaacaagcttgataccgcaaccgtagccagcctcggt
catgcgctggacgtactggaaaaacaaagcgatctcaaaggtctgctgctgcgctctgaa
aaagcggcatttatcgtcggcgcggatatcaccgaattcctctcgctgttcctggtccct
gaggagcagttaagccagtggctgcattttgctaacagcgtcttcaatcgtctggaagat
ctccccgtccccacaatctctgccgtcaatggctatgcgctgggcggcggttgcgaatgc
gtgctggcgaccgattaccgcctggcgacgccggatctgcgcattgggctgccggaaacc
aagctcggcattatgcccggcttcggcggttccgtgcgtctgccgcgcctgctcggcgcc
gatagcgcgctggaaattattgccgccgggaaagacgtcggcgccgatcaagcactgaaa
atcggcctggtggatggcgtggtcgctgcggaaaaactacgcgacggcgcgctggcgatc
ctacgtcaggccatgaatggcgacctggactggaaagcgaaacgtcagccgaagctggag
ccgctgaagctcagcaaaattgaagccgccatgagcttcacgattgccaaaggcatggtc
gcgcaaaccgccgggaagcattacccggcgccgatcaccgcggtcaaaaccattgaagcc
gccgcgcgtcttggtcgtgaagaagccctggtgctggaaaataaaagctttgtcccgctg
gcccataccaatgaggcccgcgcgctggttggtatcttcctgaacgaccagtacgtcaaa
gcgaaagcgaaaaagctgaccaaagatgtcgagacgccgaagcatgctgccgtcctgggc
gctggcattatgggcggcggtatcgcttaccagtcggcctggaagggcgtgccggtggtg
atgaaagacatcagcgacaaatcgctgaccctgggtatgaccgaagcggcgaaactgctg
aataaacagctggaacgcggcaaaatcgacggtctgaagctggccggagtgattagcacc
attcagccaacgctggaatacagcggttttgaccgcgtggacgtcgtcgttgaagcggtg
gtggaaaacccgaaagtgaagaaagccgtactagcggaaaccgagtcaaaagtgcgcccg
gataccgtgctggcgtccaacacctcaacgatccccatcagcgagctggccagcgttctg
cagcgcccggaaaacttctgcggtatgcacttctttaacccggtgcatcgcatgccgctg
gttgaagtgatccgcggcgaaaaaacctcggataataccattgccaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgattgtggtgaatgattgtcccggcttcttcgtcaac
cgggtactgttcccctacttcgccggcttcagccagctgctgcgcgacggggcggacttc
cgcaaagtcgacaaagtgatggagaaacagtttggctggccgatgggcccggcttatctg
ctggacgtggtcggcatcgataccgcgcaccatgctcaggcggtcatggcggcgggcttc
ccgcagcggatgcagaaagattatcgcgacgccatcgacgccctgtttgacgccaaccgt
ttcggccagaagaacggcctcggcttctggcgctataaagacgacagcaaaggtaagccg
aagaaagaagaagatgctgccgtcgacagcctgctggccgacgtcagccagccgaagcgc
gatttcagcgatgaagagattatcgcccgcatgatgatccccatggttaacgaagtcgtc
cgctgcctggaagaaggcattatcgccagcccggcggaagcggatatggcgctggtatac
ggcctgggcttccctccattccacggcggcgcattccgctggctggacaccatcggcagc
gcgaagtatctcgatatggcgcagcaataccagcaccttggcccgctgtatgaagtgcca
gccggtctgcgtgacaaagcgcgccataacgaagcgtattatccccaggtagagccagcc
cgtccggttggcgctctgaaaacggcttaa

DBGET integrated database retrieval system