KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04396Help
Entry
KPN_04396         CDS       T00566                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    KPN_04396 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KPN_04396 (aceA)
Enzymes [BR:kpn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     KPN_04396 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4809112..4810431
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELNKEWTNPRWEGITRPYSAEEVVKLRGSVNPECTLAQLGAAKLWR
LLHGEAKKGYVNSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLASSMYPDQSLYPAN
SVPAVVDRINNTFRRADQIQWSAGIEPNDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLVIARTDA
DAADLITSDCDPYDREFITGDRTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSKPDL
EQARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDKTIASFQQQLSVMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMRHYVEKVQQPEFAAGPEGYTFVSHQQEVGTGYFDKVTTII
QGGTSSVTALTGSTEEDQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacaaatcgaagaattaaacaaagaatgg
acgaacccgcgctgggaaggcattacccgtccctacagcgcggaagaagtggtgaagtta
cgcggctcggtgaatccggaatgcacgctggcgcagcttggcgcggcgaaactgtggcgt
ctgctgcacggggaggcgaaaaaagggtacgtcaacagtctcggcgcgctgaccggcggc
caggccttgcagcaggcgaaggcgggtatcgaagccatttatctctccggctggcaggtg
gcggcggatgctaacctggcgtccagcatgtatccggatcaatcgctgtatccggccaac
tcggtaccggcggtggtggatcggatcaacaacaccttccgccgcgccgatcagatccag
tggtcagcgggaattgaaccgaacgatccgcgctttatcgactacttcctgccgatcgtg
gcggatgcggaggccggttttggcggcgtcctgaacgcctttgagctgatgaaatcgatg
attgaagccggtgcagcggctgttcacttcgaagatcagctggcatcggtgaagaagtgc
ggccatatgggcggtaaagtgctggttccgactcaggaggcgattcagaagctggtggcg
gcgcgtctggcggccgacgtgatgggggtcccgacgctggtcatcgcccgtaccgatgcc
gacgccgcggatttaattacctcagactgcgatccgtacgatcgtgagtttattaccggg
gatcgcaccagcgaagggttcttccgcacacacgccgggatcgagcaggcgatcagccgc
gggctggcctacgcgccgtatgcggatctggtgtggtgtgaaacgtcgaaaccggatctc
gagcaggcgcgccgctttgccgaggctatccatgcgcgtttcccgggcaaactgctggcc
tataactgctcgccgtcgtttaactggaagaaaaatctcgatgataaaaccatcgccagc
ttccagcagcagttgtcggtcatgggatacaaataccagtttattaccctcgcggggatc
cacagcatgtggttcaacatgttcgacctcgcccatgcctacgctcagggtgaggggatg
cgccactatgttgagaaagtgcagcagccggaattcgccgccgggccggaaggctacacc
ttcgtctcgcatcagcaggaggtgggcaccggctacttcgacaaggtcaccaccattatc
cagggcggtacctcgtcggtaacggcgctgaccggctcgaccgaagaagatcagttttaa

DBGET integrated database retrieval system