KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04828Help
Entry
KPN_04828         CDS       T00566                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III subunit psi
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
kpn00230  Purine metabolism
kpn00240  Pyrimidine metabolism
kpn01100  Metabolic pathways
kpn03030  DNA replication
kpn03430  Mismatch repair
kpn03440  Homologous recombination
Module
kpn_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:kpn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    KPN_04828 (holD)
   00240 Pyrimidine metabolism
    KPN_04828 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KPN_04828 (holD)
   03430 Mismatch repair
    KPN_04828 (holD)
   03440 Homologous recombination
    KPN_04828 (holD)
Enzymes [BR:kpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     KPN_04828 (holD)
DNA replication proteins [BR:kpn03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     KPN_04828 (holD)
DNA repair and recombination proteins [BR:kpn03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     KPN_04828 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi CSTF_C
Motif
Other DBs
NCBI-ProteinID: ABR80171
UniProt: A6THY7
Position
5284347..5284760
Genome map
AA seq 137 aa AA seqDB search
MTSRRDWQLQQLGITQWSLRRPGALQGEIAISLPDHIRLVMVAETPPSLTEPLIGDILRA
LAVTPDQVLQLTPERVAMLPQDSRCNSWRLGTEASLPLAGAQVSTPAFDELQTSAPARRA
LWQQICAHEHDFYPQHG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacatcccgacgagactggcaattacagcagctgggcattacccagtggtcgctgcgc
cgaccgggggcgttgcagggcgaaatcgctatctcgcttcctgaccatattcgtctggtg
atggtggcggaaaccccgccgtcgctgacagagccgctgattggcgacatattacgcgcg
ctggccgtgacgccagatcaggtcctgcagctgaccccggagcgggtggcgatgctgccg
caggacagccgctgcaacagctggcggttgggcacagaggcgtcgctgccgctggcgggc
gcccaggtgtccacccccgcttttgatgaactccagaccagcgcgccggctcgcagggcg
ctctggcaacaaatctgcgcacatgaacacgatttctaccctcagcacggctga

DBGET integrated database retrieval system