KEGG   Klebsiella pneumoniae subsp. pneumoniae MGH 78578: KPN_04838Help
Entry
KPN_04838         CDS       T00566                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
kpn  Klebsiella pneumoniae subsp. pneumoniae MGH 78578
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:kpn00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5293414..5294736
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGQALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAADDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYANYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTEMARLGDRVDGQRPLAVIHAKDENSWQEAAKAVKAA
IKLDDKAPEITPTVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcaggcattaagcgatgaa
gagatccgctttttcatcaacggcatccgcgacaatactatctctgaagggcagatcgcc
gcgctggcgatgaccatcttcttccacgatatgtctatgccggagcgcgtttcgctgacc
atggcgatgcgggattccggtaccgttctggactggaaaagcctcaaccttaacggtccg
atcgtcgataaacactctaccggcggcgtcggggatgtcacttcgctgatgctggggccg
atggtggccgcctgcggtggttacgtaccgatgatctccggccgcggcctcggccatacc
ggcggtacgctggacaaactggaagcgatcccgggcttcgatatcttcccggacgacaac
cgcttccgcgagattataaaagatgttggcgtggcaattatcgggcagaccagctccctt
gccccggccgacaaacgtttctatgccacccgcgatattaccgcgacggtggactccatc
ccgctgattaccgcctcgattctggcgaagaagctggcggaagggctggatgcgctggtg
atggacgtcaaagtcggcagcggcgcctttatgccgacttatgaactctctgccgcgctg
gccgaagcgatcgtgggtgtcgccaacggcgccggcgtgcgcaccaccgcgctgctgacc
gatatgaatcaggtactggcctccagcgccggcaacgccgttgaagttcgcgaagcggtg
cagttcctgaccggcgaatatcgcaacccgcgcctgttcgacgtgacaatggcgctgtgt
gtggaaatgctgatctccggcaagctggcggcggacgatgccgaggcgcgcgcgaagctg
caggcggtgctggataacggtaaagcggcggaagtgtttggccgcatggtcgcggcgcag
aaagggccgagcgactttgtcgagaattatgctaattatctgccgacggcgatgctgagc
aaagcagtctatgctgataccgaaggttttatcagcgcgatggatactcgcgcgctgggc
atggcagtggtttctatgggcggcggccgccgtcaggcatcggacaccattgactatagc
gttggctttaccgagatggcgcgtctgggtgaccgcgtcgacggacagcgtccgctggcg
gtgatccatgccaaagacgagaacagctggcaggaggccgcgaaagcggtcaaagcggcc
attaaactggacgataaagccccggaaattacaccgacagtctatcgccgtatcactgaa
tag

DBGET integrated database retrieval system